SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g07512): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g07512): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g07512

Feature Type:gene_model
Chromosome:Gm19
Start:8908975
stop:8914849
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12420AT Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein | chr4:7349941-7352868 REVERSE LENGTH=587 SoyBaseE_val: 8.00E-78ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016051GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR11709Panther MULTI-COPPER OXIDASE JGI ISS
PTHR11709:SF11Panther MULTICOPPER OXIDASE-RELATED JGI ISS
PF00394PFAM Multicopper oxidase JGI ISS
PF07731PFAM Multicopper oxidase JGI ISS
UniRef100_B9T3G7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Multicopper oxidase, putative n=1 Tax=Ricinus communis RepID=B9T3G7_RICCO SoyBaseE_val: 6.00E-134ISS
UniRef100_UPI000233E4A8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E4A8 related cluster n=1 Tax=unknown RepID=UPI000233E4A8 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g07512 not represented in the dataset

Glyma19g07512 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g054000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g07512.1   sequence type=CDS   gene model=Glyma19g07512   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTTAATTGCTTCTGCTTTTTAACAGTTATCCCAAGTACCATATTCAGGCATTGTAACTTGTATCCGCAAGTGAATTGGATGCAGATTGTGTATTGTGAGCTGGAGTCTCTTGATGTTCATGTAGGCCAATCCTACTTAGTTCTTGTCACAACAAACCAAAATATTGCTGATTACTACATAGTAGCCTCTCCTAAACTGAGTAATGCCACAAATAATAACACTCTTGTTGGTGTTGTTGTGCTTCATTATGACAACTCTACCACACCGGCTATTGGGTCTCTTCCAAGTGGTCCAGATCCATTTGATATGCAATTCTCCATCAACCAAGAAAAATCCATTAGGTGGAACCTCACCACTGGAGCTGCAAGGCCTAATCCCCAGGGAATGTTCCATGTAACAAATGTGACAATAATTGAAACTTTCATTCTAAATGCATCAACAACAACTATTTATGGGTTATCTTGCTACTCTGTCAACAATGTGTCTTACTTGATCCCAGATACACCACTGAAACTAGCTGATTTCTTTTCCAATAGAACTGGTGTATATGAACTTGATGCTTTTTCTAAGAACACTTCAAATGCTAACGCCGTGCGTGGAGTTTTCGTAGCTAGTGCCTTGCATAAAGGTTGGACTGAGATAGTGCTAGAAAACAATTTAGACATCATTGATACTTGGCATTTGGATGGATATAGCTTCTTTGTTGTTGGAATGGGGGAAGGAGATTGGAATCCTGAATCCCGATCAAGTTATAACCTTTATGATCCTATTGCTCGCTCCACTGTGCAAGTGTACCCTGGTGGGTGGAGTTCAGTGTATGTGTACCCTGACAACCCTGGAATGTGGAACCTAAGATCACAGAACTTGCAAAGCTGGTATTTAGGTGAAGAGCTGTATGTGAGGGTTTATGATGCTGATCCCAACCCTGCCAAGGAGAAGCCACCTCCATAG

>Glyma19g07512.1   sequence type=predicted peptide   gene model=Glyma19g07512   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLNCFCFLTVIPSTIFRHCNLYPQVNWMQIVYCELESLDVHVGQSYLVLVTTNQNIADYYIVASPKLSNATNNNTLVGVVVLHYDNSTTPAIGSLPSGPDPFDMQFSINQEKSIRWNLTTGAARPNPQGMFHVTNVTIIETFILNASTTTIYGLSCYSVNNVSYLIPDTPLKLADFFSNRTGVYELDAFSKNTSNANAVRGVFVASALHKGWTEIVLENNLDIIDTWHLDGYSFFVVGMGEGDWNPESRSSYNLYDPIARSTVQVYPGGWSSVYVYPDNPGMWNLRSQNLQSWYLGEELYVRVYDADPNPAKEKPPP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo