SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g07400

Feature Type:gene_model
Chromosome:Gm19
Start:8745941
stop:8746640
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g07400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00790AT Annotation by Michelle Graham. TAIR10: ribosomal protein L16 | chrC:81189-82652 REVERSE LENGTH=135 SoyBaseE_val: 8.00E-23ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0000311GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid large ribosomal subunit SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0019843GO-mf Annotation by Michelle Graham. GO Molecular Function: rRNA binding SoyBaseN/AISS
PTHR12220Panther 50S/60S RIBOSOMAL PROTEIN L16 JGI ISS
PTHR12220:SF13Panther SUBFAMILY NOT NAMED JGI ISS
PF00252PFAM Ribosomal protein L16p/L10e JGI ISS
UniRef100_A4GG85UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L16, chloroplastic n=1 Tax=Phaseolus vulgaris RepID=RK16_PHAVU SoyBaseE_val: 5.00E-22ISS
UniRef100_I1N6W5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6W5_SOYBN SoyBaseE_val: 2.00E-57ISS

Expression Patterns of Glyma19g07400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g07400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g07400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g07400
>Glyma19g07400.1   sequence type=CDS   gene model=Glyma19g07400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTACCAAGAAACAATTGATGAGAATTTGAAAGTTACGTTTCATTGGATAAGTTTGGATGGAGGGAGTGGGAAGTTACTCAAAACAAAGCTAGCTTGGATAACATCTAGACAAATAGAAGCGGGACAACGGGCAATGTCACGAAATGTTCGCCGAGGTGGACAAATATGGGTACACATATTTCCAGACAAACCGGTTATAGTAAGACCTACTGAAACATGTATGGGTTCAGGATTCCAATTATTAAAATATGTGTAA
Predicted protein sequences of Glyma19g07400
>Glyma19g07400.1   sequence type=predicted peptide   gene model=Glyma19g07400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFYQETIDENLKVTFHWISLDGGSGKLLKTKLAWITSRQIEAGQRAMSRNVRRGGQIWVHIFPDKPVIVRPTETCMGSGFQLLKYV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo