|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00790 | AT | Annotation by Michelle Graham. TAIR10: ribosomal protein L16 | chrC:81189-82652 REVERSE LENGTH=135 | SoyBase | E_val: 8.00E-23 | ISS |
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0000311 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| GO:0019843 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: rRNA binding | SoyBase | N/A | ISS |
| PTHR12220 | Panther | 50S/60S RIBOSOMAL PROTEIN L16 | JGI | ISS | |
| PTHR12220:SF13 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00252 | PFAM | Ribosomal protein L16p/L10e | JGI | ISS | |
| UniRef100_A4GG85 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L16, chloroplastic n=1 Tax=Phaseolus vulgaris RepID=RK16_PHAVU | SoyBase | E_val: 5.00E-22 | ISS |
| UniRef100_I1N6W5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6W5_SOYBN | SoyBase | E_val: 2.00E-57 | ISS |
|
Glyma19g07400 not represented in the dataset |
Glyma19g07400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g07400.1 sequence type=CDS gene model=Glyma19g07400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTTTACCAAGAAACAATTGATGAGAATTTGAAAGTTACGTTTCATTGGATAAGTTTGGATGGAGGGAGTGGGAAGTTACTCAAAACAAAGCTAGCTTGGATAACATCTAGACAAATAGAAGCGGGACAACGGGCAATGTCACGAAATGTTCGCCGAGGTGGACAAATATGGGTACACATATTTCCAGACAAACCGGTTATAGTAAGACCTACTGAAACATGTATGGGTTCAGGATTCCAATTATTAAAATATGTGTAA
>Glyma19g07400.1 sequence type=predicted peptide gene model=Glyma19g07400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFYQETIDENLKVTFHWISLDGGSGKLLKTKLAWITSRQIEAGQRAMSRNVRRGGQIWVHIFPDKPVIVRPTETCMGSGFQLLKYV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||