Glyma19g07320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g07320

Feature Type:	gene_model
Chromosome:	Gm19
Start:	8627182
stop:	8628022
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g07320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF08213	PFAM	Mitochondrial domain of unknown function (DUF1713)	JGI		ISS
UniRef100_C6SZI0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZI0_SOYBN	SoyBase	E_val: 4.00E-80	ISS

Expression Patterns of Glyma19g07320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g07320

Paralog	Evidence	Comments
Glyma05g24090	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g07320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g053100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g07320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g07320

Limit To All Plant Sequences

>Glyma19g07320.1   sequence type=CDS   gene model=Glyma19g07320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAACCCTTCAGAAACTGCTTCGAAAACCATTACCACTACCACCCTTCAGATTCATCACTGCCCTCAACCCTCCGCAACCCCAAAACCAAAACCCCGTTCTCACTCTCACTCTCAACCCTCCCCAACAATGTCACCCTCAACCCTTCGATGATTCCCCCACCGTGATCTTTCCCAGTTTCCCCTTTGGGTTCTCCCCAAAACCGGTTTTTGAAAGCGGGTTTCGCGGCGCGGCGGAAGAAGAAGAAGACTCATCTGGAACCCTTTGGGCCGACAGCGTGAAGAAGAAGCGGAAGAAGAAGATGAACAAGCACAAGTACCAGAAGCTCAGGAAGCGCATGAGGAGACAGACGTAG

Predicted protein sequences of Glyma19g07320

Limit To All Plant Sequences

>Glyma19g07320.1   sequence type=predicted peptide   gene model=Glyma19g07320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTLQKLLRKPLPLPPFRFITALNPPQPQNQNPVLTLTLNPPQQCHPQPFDDSPTVIFPSFPFGFSPKPVFESGFRGAAEEEEDSSGTLWADSVKKKRKKKMNKHKYQKLRKRMRRQT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain