SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g07311

Feature Type:gene_model
Chromosome:Gm19
Start:8622479
stop:8622977
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g07311
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11790AT Annotation by Michelle Graham. TAIR10: arogenate dehydratase 1 | chr1:3981476-3984562 FORWARD LENGTH=341 SoyBaseE_val: 4.00E-16ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009094GO-bp Annotation by Michelle Graham. GO Biological Process: L-phenylalanine biosynthetic process SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004664GO-mf Annotation by Michelle Graham. GO Molecular Function: prephenate dehydratase activity SoyBaseN/AISS
GO:0016597GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid binding SoyBaseN/AISS
GO:0047769GO-mf Annotation by Michelle Graham. GO Molecular Function: arogenate dehydratase activity SoyBaseN/AISS
PTHR21022Panther PREPHENATE DEHYDRATASE (P PROTEIN) JGI ISS
UniRef100_B9H107UniRef Annotation by Michelle Graham. Most informative UniRef hit: Arogenate/prephenate dehydratase n=1 Tax=Populus trichocarpa RepID=B9H107_POPTR SoyBaseE_val: 2.00E-17ISS
UniRef100_I1MR49UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MR49_SOYBN SoyBaseE_val: 3.00E-18ISS

Expression Patterns of Glyma19g07311
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g07311 not represented in the dataset
Glyma19g07311 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g07311 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g053000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g07311
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g07311
>Glyma19g07311.1   sequence type=CDS   gene model=Glyma19g07311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTCTTATGGATGATGATGAGAATATTACTCGTTTCTTGGTGCTTGCAAGGGAGCCTATAATTCCAGGAACTAACAGGCCCCATAAGACTAGCATTGTTTTCAGTCTAGAAGAAGGTCCAGGTTACAACGACGTTCATAAGCCGCCCGACGTTGACATGAACAAACTCAACGACGGTGGGAAGTACACACAGTCGTTGAAAATGACAAAAACAACGACAACCTGTCCAATTCGCCGACGTTGA
Predicted protein sequences of Glyma19g07311
>Glyma19g07311.1   sequence type=predicted peptide   gene model=Glyma19g07311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESLMDDDENITRFLVLAREPIIPGTNRPHKTSIVFSLEEGPGYNDVHKPPDVDMNKLNDGGKYTQSLKMTKTTTTCPIRRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo