Glyma19g07230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g07230

Feature Type:	gene_model
Chromosome:	Gm19
Start:	8538884
stop:	8542519
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g07230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G35860	AT	Annotation by Michelle Graham. TAIR10: GTP-binding 2 \| chr4:16987118-16988839 REVERSE LENGTH=211	SoyBase	E_val: 2.00E-143	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
KOG0098	KOG	GTPase Rab2, small G protein superfamily	JGI		ISS
PTHR24073	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24073:SF246	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00071	PFAM	Ras family	JGI		ISS
UniRef100_G7KN60	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Medicago truncatula RepID=G7KN60_MEDTR	SoyBase	E_val: 4.00E-145	ISS
UniRef100_I1N6V9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6V9_SOYBN	SoyBase	E_val: 1.00E-155	ISS

Expression Patterns of Glyma19g07230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g07230

Paralog	Evidence	Comments
Glyma05g24120	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g07230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g052300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g07230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g07230

Limit To All Plant Sequences

>Glyma19g07230.1   sequence type=CDS   gene model=Glyma19g07230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTACGACTACCTCTTCAAGTACATCATCATCGGTGACACAGGTGTAGGGAAATCGTGCCTGCTCCTGCAGTTCACCGATAAGAGGTTCCAACCGGTTCATGATCTCACCATTGGTGTCGAGTTTGGTGCTCGCATGGTCACCATCGATTCTCGACCCATTAAGCTTCAGATATGGGATACAGCTGGGCAAGAGTCTTTTAGATCCATCACTAGGTCTTACTACAGAGGAGCAGCAGGAGCACTTCTAGTTTATGACATTACAAGGAGAGACACATTTAATCATTTAGCAAGTTGGCTGGAAGATGCCCGGCAGCATGCCAATCCTAACATGACCATCATGCTCATAGGGAACAAGTGTGATCTGTCTCATCGACGCGCAGTGAGCAAAGAGGAGGGAGAGCAATTTGCAAAGGAAAATGGACTTCTGTTCTTGGAGGCTTCTGCTAGGACAGCTCAAAATGTAGAAGAGGCTTTTATAAGAACTGCTGGCAAGATTCTTCAGAATATCCAGGAAGGTGTGTTTGATGTGTCCAATGAGTCATTTGGTATAAAAGTTGGCTATGGACGTCCCCAAGGTCAACCAGGTGCCAGAGATGGAACTGTTTCAGCCAGAGGTGGGTGTTGCAGCTGA

Predicted protein sequences of Glyma19g07230

Limit To All Plant Sequences

>Glyma19g07230.1   sequence type=predicted peptide   gene model=Glyma19g07230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDSRPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLASWLEDARQHANPNMTIMLIGNKCDLSHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIRTAGKILQNIQEGVFDVSNESFGIKVGYGRPQGQPGARDGTVSARGGCCS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain