Glyma19g07198 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g07198): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g07198): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g07198

Feature Type:	gene_model
Chromosome:	Gm19
Start:	8505599
stop:	8507294
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g07198

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G16110	AT	Annotation by Michelle Graham. TAIR10: response regulator 2 \| chr4:9112979-9115785 FORWARD LENGTH=664	SoyBase	E_val: 4.00E-18	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009735	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010029	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of seed germination	SoyBase	N/A	ISS
GO:0010119	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement	SoyBase	N/A	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0031537	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin metabolic process	SoyBase	N/A	ISS
GO:0048831	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of shoot development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0000156	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_B9HVU5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Type-b response regulator n=1 Tax=Populus trichocarpa RepID=B9HVU5_POPTR	SoyBase	E_val: 2.00E-17	ISS
UniRef100_UPI000233E49C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E49C related cluster n=1 Tax=unknown RepID=UPI000233E49C	SoyBase	E_val: 7.00E-22	ISS

Expression Patterns of Glyma19g07198

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g07198 not represented in the dataset	Glyma19g07198 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g07198 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g052000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g07198

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g07198

Limit To All Plant Sequences

>Glyma19g07198.1   sequence type=CDS   gene model=Glyma19g07198   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGACCTCAATTTTTGAGACGTCAGGCAGCGACTTGGCAAAGGTTGTAGTTGGTGGCATGGGGTTGGAAGCATCGGCATTACTGACAGCAAGGGTCCAAGAAAAGATCAGTTCAAATTTCAAAGAATCTAATTCTGATGAATTGGATGATTCTTTTGCACCCCCAACAAAGAAACCTCGTCTAGTGTGGAAACAAGAATTGCATCAACAATTTGTCGAGGCTGTTATGCAAATTGCACTTGATAAGGCAAAGTCAAAAAGGATTATTGAAGCTATGAATATCCTTGGTTTGACAAGAGAGCAAGTAGCTAGTCATTTGCAGAAACATGGACATGAGTTGTTGTTGTTGAATACATCTAAAGGAGTGACATTGTAA

Predicted protein sequences of Glyma19g07198

Limit To All Plant Sequences

>Glyma19g07198.1   sequence type=predicted peptide   gene model=Glyma19g07198   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTSIFETSGSDLAKVVVGGMGLEASALLTARVQEKISSNFKESNSDELDDSFAPPTKKPRLVWKQELHQQFVEAVMQIALDKAKSKRIIEAMNILGLTREQVASHLQKHGHELLLLNTSKGVTL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain