SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g07186

Feature Type:gene_model
Chromosome:Gm19
Start:8495423
stop:8495749
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG01310AT Annotation by Michelle Graham. TAIR10: ribosomal protein L2 | chrC:152806-154312 FORWARD LENGTH=274 SoyBaseE_val: 4.00E-39ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0000311GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid large ribosomal subunit SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
PTHR13691Panther RIBOSOMAL PROTEIN L2 JGI ISS
PTHR13691:SF5Panther gb def: ribosomal protein l2 [cafeteria roenbergensis] JGI ISS
PF03947PFAM Ribosomal Proteins L2, C-terminal domain JGI ISS
UniRef100_I1N6V5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N6V5_SOYBN SoyBaseE_val: 1.00E-54ISS
UniRef100_P18663UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L2-A, chloroplastic n=1 Tax=Glycine max RepID=RK2A_SOYBN SoyBaseE_val: 9.00E-38ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g07186 not represented in the dataset

Glyma19g07186 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g051900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g07186.1   sequence type=CDS   gene model=Glyma19g07186   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTTGTAAGAAGCTTGTACAGTTTGGGAAGAGGTTTTTAGCTACAGTAGGAGGTGCTATAGCGAAACTAATTACAAAAGAGGGGAAATCGGCCACATTAAAATTACCTTCTGGGGAGGTCCGTTTGGGAAATGTTGGAGTAAACCAGAAAAATTTAGGTAGAGCCAGATCTAAATGTTGGTTAGGTAAGCATCCTGTAGTAAGAGGAGTAGTTATGAACCCCGTAGACCATCCGCATGAGGGTGGTGAAGGGAGGGCCCCAATTGGTAGGAAAAAAACCCGCAACTCCTTGGGATTTTCCAGCACTTGGAAGAAGATAATTTGA

>Glyma19g07186.1   sequence type=predicted peptide   gene model=Glyma19g07186   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLCKKLVQFGKRFLATVGGAIAKLITKEGKSATLKLPSGEVRLGNVGVNQKNLGRARSKCWLGKHPVVRGVVMNPVDHPHEGGEGRAPIGRKKTRNSLGFSSTWKKII*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo