SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g07174

Feature Type:gene_model
Chromosome:Gm19
Start:8469074
stop:8471843
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g07174
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16857AT Annotation by Michelle Graham. TAIR10: response regulator 1 | chr3:5756113-5758853 FORWARD LENGTH=669 SoyBaseE_val: 1.00E-19ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0010029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed germination SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0010380GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0031537GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin metabolic process SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0048831GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of shoot development SoyBaseN/AISS
GO:0080022GO-bp Annotation by Michelle Graham. GO Biological Process: primary root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00072PFAM Response regulator receiver domain JGI ISS
UniRef100_G7LD69UniRef Annotation by Michelle Graham. Most informative UniRef hit: Two-component response regulator ARR2 n=1 Tax=Medicago truncatula RepID=G7LD69_MEDTR SoyBaseE_val: 2.00E-19ISS
UniRef100_I1K2M3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K2M3_SOYBN SoyBaseE_val: 4.00E-35ISS

Expression Patterns of Glyma19g07174
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g07174 not represented in the dataset
Glyma19g07174 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g07174 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g051800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g07174
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g07174
>Glyma19g07174.1   sequence type=CDS   gene model=Glyma19g07174   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCACTTGCAGTGCTTCTCGGACATGTGCGCAAGTTTTTGCTCCGGATCCCAAAAATGTCGGAGACGGCACTGCTCACTTGAAGAGTATGTTCGGGAGAAAACACATTGCATTGATGTGATACTCATTGAAGTTCACATGCCATATGTCGATAGCCTTCAATTCCTTCAGCATGTCACTAACGAAACTAATGTTCCAGTTATCATGATGTCTCTTGATGATGCTCAGAGTACTGTGATGAAGGCTATTAGAAATGGAGCTTGCAATTATTGGCTTAAGCCTTTGCAAGAGAGCCTAATCAAGGTTATGTGGATGGAATATGCTAGGAAACTCGAGTCAAAATATGCTACCAAGAAAAGAAGATTCTGA
Predicted protein sequences of Glyma19g07174
>Glyma19g07174.1   sequence type=predicted peptide   gene model=Glyma19g07174   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHLQCFSDMCASFCSGSQKCRRRHCSLEEYVREKTHCIDVILIEVHMPYVDSLQFLQHVTNETNVPVIMMSLDDAQSTVMKAIRNGACNYWLKPLQESLIKVMWMEYARKLESKYATKKRRF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo