SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g06730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g06730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g06730

Feature Type:gene_model
Chromosome:Gm19
Start:7895437
stop:7897983
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02560AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S7e family protein | chr3:542341-543168 FORWARD LENGTH=191 SoyBaseE_val: 2.00E-115ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042274GO-bp Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0030686GO-cc Annotation by Michelle Graham. GO Cellular Compartment: 90S preribosome SoyBaseN/AISS
GO:0032040GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small-subunit processome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3320 KOG 40S ribosomal protein S7 JGI ISS
PTHR11278Panther 40S RIBOSOMAL PROTEIN S7 JGI ISS
PF01251PFAM Ribosomal protein S7e JGI ISS
UniRef100_B9SZQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S7, putative n=1 Tax=Ricinus communis RepID=B9SZQ7_RICCO SoyBaseE_val: 1.00E-122ISS
UniRef100_I1N6T0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6T0_SOYBN SoyBaseE_val: 2.00E-135ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g06730 not represented in the dataset

Glyma19g06730 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g07650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g049200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g06730.1   sequence type=CDS   gene model=Glyma19g06730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACACCTCGAGGAAGAAAATTCACAAGGATAAGGATGCCGAGCCCACTGAATTTGAGGAGACAGTTGGACAGTACTTGTTCGACTTGGAGAACACCAATCAGGATCTGAAAAGTGACTTGAAAGATCTCTACATAAACCAAGCTATTCAAATGGATGTGGCTGGTAATCGCAAGGCTGTAGTCATCTATGTGCCTTTCAGATTGAGGAAGGCATTCCGCAAGATTCATCTTCGACTTGTCAGAGAGTTGGAGAAGAAGTTTAGTGGGAAGGATGTTGTCTTGATTGCCACAAGGAGGATCGTGCGACCGCCAAAGAAAGGCTCTGCTGTTCAGCGACCCCGAACCCGCACTTTGACCGCTGTCCATGATGCCATGCTGGAGGATGTTGTGTATCCTGCAGAGATTGTTGGCAAACGGGCCAGATATAGAATTGATGGCTCAAAAATAATGAAGGTTTTCTTGGACCCCAAGGAGCGCAACAACACTGAGTACAAGCTGGAGACCTTTTCTGGAGTTTACAGGAAGCTTACTGGAAAAGATGTAGTATTTGAGTATCCAATCTCAGAAGCCTGA

>Glyma19g06730.1   sequence type=predicted peptide   gene model=Glyma19g06730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYTSRKKIHKDKDAEPTEFEETVGQYLFDLENTNQDLKSDLKDLYINQAIQMDVAGNRKAVVIYVPFRLRKAFRKIHLRLVRELEKKFSGKDVVLIATRRIVRPPKKGSAVQRPRTRTLTAVHDAMLEDVVYPAEIVGKRARYRIDGSKIMKVFLDPKERNNTEYKLETFSGVYRKLTGKDVVFEYPISEA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo