Glyma19g06460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g06460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g06460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g06460

Feature Type:	gene_model
Chromosome:	Gm19
Start:	7403619
stop:	7405686
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g06460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G02450	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L36e family protein \| chr5:533501-534394 FORWARD LENGTH=108	SoyBase	E_val: 4.00E-53	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3452	KOG	60S ribosomal protein L36	JGI		ISS
PTHR10114	Panther	60S RIBOSOMAL PROTEIN L36E	JGI		ISS
PF01158	PFAM	Ribosomal protein L36e	JGI		ISS
UniRef100_I1N6R2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L36 n=1 Tax=Glycine max RepID=I1N6R2_SOYBN	SoyBase	E_val: 1.00E-75	ISS
UniRef100_I1N6R2	UniRef	Annotation by Michelle Graham. Best UniRef hit: 60S ribosomal protein L36 n=1 Tax=Glycine max RepID=I1N6R2_SOYBN	SoyBase	E_val: 1.00E-75	ISS

Expression Patterns of Glyma19g06460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g06460 not represented in the dataset	Glyma19g06460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g06460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g047300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g06460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma19g06460

Limit To All Plant Sequences

>Glyma19g06460.2   sequence type=transcript   gene model=Glyma19g06460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCTCAGATATTACCGAGAGTGGATCCACAAGGCCCAACTTTAGCCTCTCATATAAAACCCGAAGCAGGTTCGGGAAGAACCCTAGTTTCTGTTCTCCCTCTTTCACCGCAGTGTTAGGGTTTCTGTAGCCTCCAACCAGAAAGAGAGGGAAATGGCTCCCAAACATCCTAGTACGGGTTTGTTTGTTGGATTGAACAAGGGTCACGTTGTCACCAAGAAGGAGTTGCCTCCACGCCCTTCAGATCGTAAGGGGAAAACAAGCAAGCGAGTGCACTTTGTGAGGAACCTCATTCGAGAGGTTGCCGGCTTTGCACCTTATGAAAAGCGAATAACTGAGTTGCTCAAGGTTGGAAAAGATAAGAGGGCACTGAAAGTTGCCAAGAGAAAGCTTGGAACCCATAAGCGCGCAAAGAAGAAGAGAGAGGAGATGTCCAATGTTCTCCGGAAGATGAGGGCTGGTGGAGCTGGAGACAAGAAGAAATAAGTCTTGTTTACTTTTTCTAGTTTCACTAGACTGTTTCGATGTACGAGTTGTCTTATTTTTGTTTTAGTTCAAGATTTTGCTTTGAGAAATATGTTTTACCTAATCGAGACATGATTTACTGAAAAAGTACAATTGGCTTATTTTCGACATGCATTCCAAATTGATGTTTTATTGTTACATATTGAAAAATGTTGTAAGCCTGTCTGAGGAGGTTTATCATATATTCATTTGTGTATATTTTTGAAAATGCAAATTCAA

Coding sequences of Glyma19g06460

Limit To All Plant Sequences

>Glyma19g06460.1   sequence type=CDS   gene model=Glyma19g06460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCAAACATCCTAGTACGGGTTTGTTTGTTGGATTGAACAAGGGTCACGTTGTCACCAAGAAGGAGTTGCCTCCACGCCCTTCAGATCGTAAGGGGAAAACAAGCAAGCGAGTGCACTTTGTGAGGAACCTCATTCGAGAGGTTGCCGGCTTTGCACCTTATGAAAAGCGAATAACTGAGTTGCTCAAGGTTGGAAAAGATAAGAGGGCACTGAAAGTTGCCAAGAGAAAGCTTGGAACCCATAAGCGCGCAAAGAAGAAGAGAGAGGAGATGTCCAATGTTCTCCGGAAGATGAGGTTGCTCTATGTTCTTTTTTCAATATTATGCGTACCCTATAATTAA

>Glyma19g06460.2   sequence type=CDS   gene model=Glyma19g06460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCAAACATCCTAGTACGGGTTTGTTTGTTGGATTGAACAAGGGTCACGTTGTCACCAAGAAGGAGTTGCCTCCACGCCCTTCAGATCGTAAGGGGAAAACAAGCAAGCGAGTGCACTTTGTGAGGAACCTCATTCGAGAGGTTGCCGGCTTTGCACCTTATGAAAAGCGAATAACTGAGTTGCTCAAGGTTGGAAAAGATAAGAGGGCACTGAAAGTTGCCAAGAGAAAGCTTGGAACCCATAAGCGCGCAAAGAAGAAGAGAGAGGAGATGTCCAATGTTCTCCGGAAGATGAGGGCTGGTGGAGCTGGAGACAAGAAGAAATAA

Predicted protein sequences of Glyma19g06460

Limit To All Plant Sequences

>Glyma19g06460.1   sequence type=predicted peptide   gene model=Glyma19g06460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKHPSTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRLLYVLFSILCVPYN*

>Glyma19g06460.2   sequence type=predicted peptide   gene model=Glyma19g06460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKHPSTGLFVGLNKGHVVTKKELPPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKMRAGGAGDKKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain