SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g06420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g06420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g06420

Feature Type:gene_model
Chromosome:Gm19
Start:7330964
stop:7331645
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g06420
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G67090AT Annotation by Michelle Graham. TAIR10: ribulose bisphosphate carboxylase small chain 1A | chr1:25048465-25049249 REVERSE LENGTH=180 SoyBaseE_val: 3.00E-25ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0015977GO-bp Annotation by Michelle Graham. GO Biological Process: carbon fixation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0080158GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast ribulose bisphosphate carboxylase complex biogenesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009573GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ribulose bisphosphate carboxylase complex SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016984GO-mf Annotation by Michelle Graham. GO Molecular Function: ribulose-bisphosphate carboxylase activity SoyBaseN/AISS
PF00101PFAM Ribulose bisphosphate carboxylase, small chain JGI ISS
UniRef100_I1N6R0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribulose bisphosphate carboxylase small chain (Fragment) n=1 Tax=Glycine max RepID=I1N6R0_SOYBN SoyBaseE_val: 7.00E-86ISS
UniRef100_I1N6R0UniRef Annotation by Michelle Graham. Best UniRef hit: Ribulose bisphosphate carboxylase small chain (Fragment) n=1 Tax=Glycine max RepID=I1N6R0_SOYBN SoyBaseE_val: 7.00E-86ISS

Expression Patterns of Glyma19g06420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g06420 not represented in the dataset
Glyma19g06420 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g06420 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g06420
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g06420
>Glyma19g06420.1   sequence type=CDS   gene model=Glyma19g06420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGTGGCAACCAATTGGCAAGAAGTTTGAGACTCTTTCCTACCTGCCTAACCTTGATGATGCACAATTGGCAAAGGAAGTAGAGTACCTTCTTAGGAACGGATGGATTCCTTGCTTGGAATTCGAGTTGGAGTTTTCCTTAGTTTTGTTTTTTGTTTCAACTTATTTTGAAGAAATAATTGTTTTTCATGCCATTTTGATGGTTGATCTGTCCGTTTGCAGCACGGTTTCGTGTACCGTGAGCACAACAGATCACCAAGATACTATGATGGACGCTACTAGACCATGTGGAAGCTGCCTATGTTTGGCCAAGACTACATACCCCAACGCCTTCATCCGTATCATCGGATTCGACAACGTTCGCCAAGTGTAG
Predicted protein sequences of Glyma19g06420
>Glyma19g06420.1   sequence type=predicted peptide   gene model=Glyma19g06420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VWQPIGKKFETLSYLPNLDDAQLAKEVEYLLRNGWIPCLEFELEFSLVLFFVSTYFEEIIVFHAILMVDLSVCSTVSCTVSTTDHQDTMMDATRPCGSCLCLAKTTYPNAFIRIIGFDNVRQV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo