|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G38410 | AT | Annotation by Michelle Graham. TAIR10: Ribulose bisphosphate carboxylase (small chain) family protein | chr5:15377501-15378306 REVERSE LENGTH=174 | SoyBase | E_val: 1.00E-56 | ISS |
| GO:0009637 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to blue light | SoyBase | N/A | ISS |
| GO:0010114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to red light | SoyBase | N/A | ISS |
| GO:0010218 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to far red light | SoyBase | N/A | ISS |
| GO:0015977 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbon fixation | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0080158 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast ribulose bisphosphate carboxylase complex biogenesis | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009573 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ribulose bisphosphate carboxylase complex | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0016984 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ribulose-bisphosphate carboxylase activity | SoyBase | N/A | ISS |
| PF00101 | PFAM | Ribulose bisphosphate carboxylase, small chain | JGI | ISS | |
| PF12338 | PFAM | Ribulose-1,5-bisphosphate carboxylase small subunit | JGI | ISS | |
| UniRef100_I1N6Q9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ribulose bisphosphate carboxylase small chain n=1 Tax=Glycine max RepID=I1N6Q9_SOYBN | SoyBase | E_val: 4.00E-83 | ISS |
| UniRef100_I1N6Q9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Ribulose bisphosphate carboxylase small chain n=1 Tax=Glycine max RepID=I1N6Q9_SOYBN | SoyBase | E_val: 4.00E-83 | ISS |
|
Glyma19g06390 not represented in the dataset |
Glyma19g06390 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g046900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g06390.2 sequence type=CDS gene model=Glyma19g06390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTTCCTCACCGATCTCCTCCCCAGTAGTTACCATCATTAACCGTGTCGGTGTCAGCATGGTTGCCCCTTTCACTGGCCTCAAATCCATGGCTGGCATCCCTACCAGGAAGACCAACAGTGACATTACCTCCATTGCTACCAATGGTGGAAGAGTGTGGCCTCCAGTTGGCAAGAAGAAGTTTGGGACTTTTTCCTACCTGCCAGACCTTGATGATGCCCAATTGGCTAAGGAAACCATATGGAAGCATCCTATGTTTGGTTGCACTGATGCTTCTCAGGTGTTAAAGGAGCTTCAAGAGGCTAAGACTACATACCCCAACTCCTTCATTCGTATCATCGGATTCGACAACATTCGCCAAGTGCAGTGCATAAGCTTCATCGCCTACAAGCCCCCAGACTTCTAA
>Glyma19g06390.2 sequence type=predicted peptide gene model=Glyma19g06390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASSPISSPVVTIINRVGVSMVAPFTGLKSMAGIPTRKTNSDITSIATNGGRVWPPVGKKKFGTFSYLPDLDDAQLAKETIWKHPMFGCTDASQVLKELQEAKTTYPNSFIRIIGFDNIRQVQCISFIAYKPPDF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||