Glyma19g06320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g06320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g06320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g06320

Feature Type:	gene_model
Chromosome:	Gm19
Start:	7169150
stop:	7170342
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g06320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G05110	AT	Annotation by Michelle Graham. TAIR10: equilibrative nucleoside transporter 6 \| chr4:2626516-2628685 REVERSE LENGTH=418	SoyBase	E_val: 9.00E-34	ISS
GO:0015858	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005337	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside transmembrane transporter activity	SoyBase	N/A	ISS
PTHR10332	Panther	EQUILIBRATIVE NUCLEOSIDE TRANSPORTER ENT (SLC29)	JGI		ISS
PTHR10332:SF3	Panther	EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 4-RELATED	JGI		ISS
UniRef100_B9H1Z9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Equilibrative nucleoside transporter n=1 Tax=Populus trichocarpa RepID=B9H1Z9_POPTR	SoyBase	E_val: 4.00E-38	ISS
UniRef100_B9H1Z9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Equilibrative nucleoside transporter n=1 Tax=Populus trichocarpa RepID=B9H1Z9_POPTR	SoyBase	E_val: 4.00E-38	ISS

Expression Patterns of Glyma19g06320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g06320 not represented in the dataset	Glyma19g06320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g06320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g06320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g06320

Limit To All Plant Sequences

>Glyma19g06320.1   sequence type=CDS   gene model=Glyma19g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAGGCAGTGATGATGGGTGGGGTCCTGTTTGGAAAAAGCACTGTTGTTGGCAGTGAAATATTACCGTTCAAAAGCAGTGTTAGAGGATTGCTGCTGACCTTATTTGGAACTTTTTTGATTTATTTTTTATATGTGGTAACACTGTCAATCTTCCCTGGATTTTTGTGTGAAAATACTCGAACACATCAGTTAGGCACATGGTACCCAGTTGTTTTAATTGGTATGTATAGTGGATTTCATAGCAAGATTAAGGGTCTACTAATAGCATTGTTTTCTAGATTCTTGTTGATCCCAGCATTCTACTTCACAACAAAATATGGTGACCAGGGATGGATGATCCTGCTAACCTCCTTCTTGGGACTCACCAATGGCTATCTCACTATTTTTGTTCTCACTGTGGCACGAAGAGGTTACAAGGCA

Predicted protein sequences of Glyma19g06320

Limit To All Plant Sequences

>Glyma19g06320.1   sequence type=predicted peptide   gene model=Glyma19g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKAVMMGGVLFGKSTVVGSEILPFKSSVRGLLLTLFGTFLIYFLYVVTLSIFPGFLCENTRTHQLGTWYPVVLIGMYSGFHSKIKGLLIALFSRFLLIPAFYFTTKYGDQGWMILLTSFLGLTNGYLTIFVLTVARRGYKA

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain