SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g05941

Feature Type:gene_model
Chromosome:Gm19
Start:6613380
stop:6614162
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g05941
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51290AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF630) ;Protein of unknown function (DUF632) | chr3:19039980-19044215 FORWARD LENGTH=798 SoyBaseE_val: 7.00E-129ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0016458GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
PTHR21450Panther UNCHARACTERIZED JGI ISS
PF04782PFAM Protein of unknown function (DUF632) JGI ISS
UniRef100_D7LTT2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proline-rich family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LTT2_ARALL SoyBaseE_val: 4.00E-95ISS
UniRef100_I1J8J5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J8J5_SOYBN SoyBaseE_val: 2.00E-174ISS

Expression Patterns of Glyma19g05941
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05941 not represented in the dataset
Glyma19g05941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05941 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g05941
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g05941
>Glyma19g05941.1   sequence type=CDS   gene model=Glyma19g05941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTAATGTGCATGTGGAGAAGCATGTATGAGTGTCACCAAGTCCAAAAGCACATAGTTCAGCAGCTAGAGTACCTCAACACCATACCATCAAAAAACCCTACATCTGAGATTCACAAACAATCAACTCTTCAGCTGGAGCTTGAAGTACAGCAGTGGCACCAATCCTTCTGCAACCTCTTCAAGGCCCACCACGACTACATCCAATCCCTCACAGGTTGGCTAAGGCTCACCCTTTTCCAGTTCAGCAAAACCCCTATAAACCGAACCCCCGAGGAGTCTAAGATATACACCCTTTGTGAAGAATGGCACCTCGCCGTCGACCGCATTCCGGACAAGGTAGCATCCGAAGGAATAAAAATCTTGTTGACAGTTATTCATGCCATTGCACTGCAACAGGCAAAGGAGCAGAAACAGAAAAAGAAGTCAGATTCCACATTCAAAGAGCTCGAGAAGAAGGTGGTTCAGCTGCGATCCTTGGAGTGCAAGTATGGTCCATACTCCATGCCAGAATCATCTGGCAGCTTGAGAACCAGGGACCCGATCACCGAGAAGCGCACTAAGGTGGATGCCTTGAAAGCAAAGGCAGACGAAGAGAAGAGCAAATACAACAAGTCAGTGAGTGTAACGAGGGCAATGACACTGAACAACTTGCAAATGGGTTGCCCTCATGTGTTTCAAGGGATTGTGGGGTTTTCAAGTGTGTGCATGGAGGTTTTTGAGTCTGTATACAACAAAGCCAAAGCTTCTGAACAGGAGCATGACGTGAAGAGAATATTACCATAA
Predicted protein sequences of Glyma19g05941
>Glyma19g05941.1   sequence type=predicted peptide   gene model=Glyma19g05941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LMCMWRSMYECHQVQKHIVQQLEYLNTIPSKNPTSEIHKQSTLQLELEVQQWHQSFCNLFKAHHDYIQSLTGWLRLTLFQFSKTPINRTPEESKIYTLCEEWHLAVDRIPDKVASEGIKILLTVIHAIALQQAKEQKQKKKSDSTFKELEKKVVQLRSLECKYGPYSMPESSGSLRTRDPITEKRTKVDALKAKADEEKSKYNKSVSVTRAMTLNNLQMGCPHVFQGIVGFSSVCMEVFESVYNKAKASEQEHDVKRILP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo