Report for Sequence Feature Glyma19g05650
Feature Type: gene_model
Chromosome: Gm19
Start: 6224264
stop: 6224589
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma19g05650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g05650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g042300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g05650
Coding sequences of Glyma19g05650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g05650.1 sequence type=CDS gene model=Glyma19g05650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTACACCTATTTATCCCTAATGCAACTATTTGTACAAGTATAGGAGCTTCTCGGTACCTCTATTACATCATATCTCTAATCCTAATCAACTTTCCTACAAAACTGTATGCAGTTTTAAAGTTCCGAAAATTAGATGGACTGATTGATGATTTGTTTGAATGA
Predicted protein sequences of Glyma19g05650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g05650.1 sequence type=predicted peptide gene model=Glyma19g05650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVHLFIPNATICTSIGASRYLYYIISLILINFPTKLYAVLKFRKLDGLIDDLFE*