SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g05520

Feature Type:gene_model
Chromosome:Gm19
Start:6028373
stop:6030689
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g05520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22680AT Annotation by Michelle Graham. TAIR10: RNA-DIRECTED DNA METHYLATION 1 | chr3:8019785-8020374 FORWARD LENGTH=163 SoyBaseE_val: 3.00E-37ISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0044030GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA methylation SoyBaseN/AISS
GO:0070918GO-bp Annotation by Michelle Graham. GO Biological Process: production of small RNA involved in gene silencing by RNA SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043621GO-mf Annotation by Michelle Graham. GO Molecular Function: protein self-association SoyBaseN/AISS
PF09187PFAM Domain of unknown function(DUF1950) JGI ISS
UniRef100_I1N6K7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N6K7_SOYBN SoyBaseE_val: 3.00E-82ISS
UniRef100_Q9LUJ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein RDM1 n=1 Tax=Arabidopsis thaliana RepID=RDM1_ARATH SoyBaseE_val: 1.00E-34ISS

Expression Patterns of Glyma19g05520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g043300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g05520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g05520
>Glyma19g05520.2   sequence type=CDS   gene model=Glyma19g05520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACGCAACCATCGTTTTGCTAGCTACAAACACATGTTGGTGTCAGACTCTGAAACTGAGTCTGATGATAACCTTAGCAAAATTGCTGTAGCTGTTGATGATGCTCTAGTAAAGCTTGCAAAGAAATATCAAAAGCACATGCAGAACAAGCCTATTCCAACAAGCCGTCTAAACAAAGAAATTATGGTTGTGAACTGGAAAGGTTTGGCCAAAACCTTGGAGAGAATGTATGGGCAACCATTACATTATCTAACACACAAGCTTTGTAAAGAATGGGACAAGTCAAGGTTTGGAAGTAAAAATGAAGAGAAACCATTGAATGCGATTATTAATTGGCGCGACGCTGAAGACACTATATGGAAAGTTGAAGCAGTCCATAGGCTTTGCACTTCCCCTATTCATCTTGCAATGCTTTGGCTTGATGATCCAACATACCATATTTTTGTTAATGAAGTTATTACAGCCCCTTCAAGTTCAATAAAATAG
Predicted protein sequences of Glyma19g05520
>Glyma19g05520.2   sequence type=predicted peptide   gene model=Glyma19g05520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRNHRFASYKHMLVSDSETESDDNLSKIAVAVDDALVKLAKKYQKHMQNKPIPTSRLNKEIMVVNWKGLAKTLERMYGQPLHYLTHKLCKEWDKSRFGSKNEEKPLNAIINWRDAEDTIWKVEAVHRLCTSPIHLAMLWLDDPTYHIFVNEVITAPSSSIK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo