SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g05503): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g05503): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g05503

Feature Type:gene_model
Chromosome:Gm19
Start:5992711
stop:5993661
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g05503
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G59420AT Annotation by Michelle Graham. TAIR10: OSBP(oxysterol binding protein)-related protein 3C | chr5:23961731-23964623 FORWARD LENGTH=457 SoyBaseE_val: 8.00E-40ISS
GO:0008202GO-bp Annotation by Michelle Graham. GO Biological Process: steroid metabolic process SoyBaseN/AISS
GO:0009610GO-bp Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0046482GO-bp Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0008142GO-mf Annotation by Michelle Graham. GO Molecular Function: oxysterol binding SoyBaseN/AISS
PTHR10972Panther OXYSTEROL-BINDING PROTEIN JGI ISS
PTHR10972:SF8Panther OXYSTEROL-BINDING PROTEIN-RELATED JGI ISS
PF01237PFAM Oxysterol-binding protein JGI ISS
UniRef100_C6THD1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6THD1_SOYBN SoyBaseE_val: 4.00E-42ISS
UniRef100_G7JUT2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oxysterol-binding protein n=2 Tax=Medicago truncatula RepID=G7JUT2_MEDTR SoyBaseE_val: 5.00E-38ISS

Expression Patterns of Glyma19g05503
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05503 not represented in the dataset
Glyma19g05503 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05503 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g043400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g05503
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g05503
>Glyma19g05503.1   sequence type=CDS   gene model=Glyma19g05503   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTCGGAAAATTGTTGAGTACTCCTACTTGTTAGATCAAGTAGATGAATTAGATGATCCATACATGCAAAAGCCTTTTAATCCTATCCTTGGAGAGACTTATGACATGGTTAACCATGGTGGAATTACATTTCTTGTTGAACGGGTAAGTCATCATCCCTCAATGAGTGTTATGTATGCTAAAAATGAGCATTTTACATATGATGTGACTTCAAAGTTGAAAACTAAGTTTTTGGGAAACTCTGTTGATGTTTACCCTGTTGGAAGGTGA
Predicted protein sequences of Glyma19g05503
>Glyma19g05503.1   sequence type=predicted peptide   gene model=Glyma19g05503   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRKIVEYSYLLDQVDELDDPYMQKPFNPILGETYDMVNHGGITFLVERVSHHPSMSVMYAKNEHFTYDVTSKLKTKFLGNSVDVYPVGR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo