|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G18800 | AT | Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A1D | chr4:10320156-10321339 REVERSE LENGTH=214 | SoyBase | E_val: 1.00E-38 | ISS |
GO:0007264 | GO-bp | Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction | SoyBase | N/A | ISS |
GO:0015031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein transport | SoyBase | N/A | ISS |
GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0031901 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: early endosome membrane | SoyBase | N/A | ISS |
GO:0032588 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network membrane | SoyBase | N/A | ISS |
GO:0005525 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: GTP binding | SoyBase | N/A | ISS |
PTHR24073 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR24073:SF213 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
PF00071 | PFAM | Ras family | JGI | ISS | |
UniRef100_I1N6K5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6K5_SOYBN | SoyBase | E_val: 1.00E-39 | ISS |
UniRef100_Q8LJR5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Glycine max RepID=Q8LJR5_SOYBN | SoyBase | E_val: 2.00E-39 | ISS |
Glyma19g05486 not represented in the dataset |
Glyma19g05486 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.19g043600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g05486.1 sequence type=CDS gene model=Glyma19g05486 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTAGGGTACAAGGGCGATGACGAGTACGATTACCTCTTCAAGCTGGTTCTGATCAGCGATTCTGGTGTGGGGAAGTCCAACCTACTTTCGCACTTCACCAGGAACGAGTTCAATTTGGAGTCCAAGTCCACCATAGGGGTTGAGTTCAGAAAAAAGAGCTTGAACATCAATGCTAAGGTCATCAAGGCTCAGATTTGGGACACCGCTGGCCAGGAAAGCTTCCCTTGCCTTTTGAATTTTTCTCATAATTCATTGTTTTTAGGAACATATACATGCAAGCATTAA
>Glyma19g05486.1 sequence type=predicted peptide gene model=Glyma19g05486 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLGYKGDDEYDYLFKLVLISDSGVGKSNLLSHFTRNEFNLESKSTIGVEFRKKSLNINAKVIKAQIWDTAGQESFPCLLNFSHNSLFLGTYTCKH*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||