SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g05486): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g05486): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g05486

Feature Type:gene_model
Chromosome:Gm19
Start:5959837
stop:5961587
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G18800AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A1D | chr4:10320156-10321339 REVERSE LENGTH=214 SoyBaseE_val: 1.00E-38ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0031901GO-cc Annotation by Michelle Graham. GO Cellular Compartment: early endosome membrane SoyBaseN/AISS
GO:0032588GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF213Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_I1N6K5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6K5_SOYBN SoyBaseE_val: 1.00E-39ISS
UniRef100_Q8LJR5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Glycine max RepID=Q8LJR5_SOYBN SoyBaseE_val: 2.00E-39ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05486 not represented in the dataset

Glyma19g05486 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g043600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g05486.1   sequence type=CDS   gene model=Glyma19g05486   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGGGTACAAGGGCGATGACGAGTACGATTACCTCTTCAAGCTGGTTCTGATCAGCGATTCTGGTGTGGGGAAGTCCAACCTACTTTCGCACTTCACCAGGAACGAGTTCAATTTGGAGTCCAAGTCCACCATAGGGGTTGAGTTCAGAAAAAAGAGCTTGAACATCAATGCTAAGGTCATCAAGGCTCAGATTTGGGACACCGCTGGCCAGGAAAGCTTCCCTTGCCTTTTGAATTTTTCTCATAATTCATTGTTTTTAGGAACATATACATGCAAGCATTAA

>Glyma19g05486.1   sequence type=predicted peptide   gene model=Glyma19g05486   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGYKGDDEYDYLFKLVLISDSGVGKSNLLSHFTRNEFNLESKSTIGVEFRKKSLNINAKVIKAQIWDTAGQESFPCLLNFSHNSLFLGTYTCKH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo