Report for Sequence Feature Glyma19g05470
Feature Type: gene_model
Chromosome: Gm19
Start: 5947893
stop: 5948119
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g05470
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G41390 AT
Annotation by Michelle Graham. TAIR10: PLAC8 family protein | chr5:16565576-16567253 FORWARD LENGTH=264
SoyBase E_val: 9.00E-22 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I3SV90 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Medicago truncatula RepID=I3SV90_MEDTR
SoyBase E_val: 1.00E-23 ISS
UniRef100_Q9FN61 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAF07369.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FN61_ARATH
SoyBase E_val: 8.00E-20 ISS
Expression Patterns of Glyma19g05470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g05470 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma19g05470
Coding sequences of Glyma19g05470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g05470.1 sequence type=CDS gene model=Glyma19g05470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GCACCATGTGTGTCTTACCTTCTTCGCAAACGAGCCCTCTATGATGATATGTCAAGGTACACATTTTGTGCTGGCTACATGCCTTGCAGTGGTAGGTGTGGAGAAAGTAAATGTCCTGAGTTTTGCCTTTGCACTGAG
Predicted protein sequences of Glyma19g05470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g05470.1 sequence type=predicted peptide gene model=Glyma19g05470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
APCVSYLLRKRALYDDMSRYTFCAGYMPCSGRCGESKCPEFCLCTE