SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g05400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g05400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g05400

Feature Type:gene_model
Chromosome:Gm19
Start:5834953
stop:5835381
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g05400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G24503AT Annotation by Michelle Graham. TAIR10: aldehyde dehydrogenase 2C4 | chr3:8919732-8923029 REVERSE LENGTH=501 SoyBaseE_val: 8.00E-27ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009699GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid biosynthetic process SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004028GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-chloroallyl aldehyde dehydrogenase activity SoyBaseN/AISS
GO:0004029GO-mf Annotation by Michelle Graham. GO Molecular Function: aldehyde dehydrogenase (NAD) activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0050269GO-mf Annotation by Michelle Graham. GO Molecular Function: coniferyl-aldehyde dehydrogenase activity SoyBaseN/AISS
PTHR11699Panther ALDEHYDE DEHYDROGENASE-RELATED JGI ISS
PTHR11699:SF46Panther SUCCINATE-SEMIALDEHYDE DEHYDROGENASE-RELATED JGI ISS
PF00171PFAM Aldehyde dehydrogenase family JGI ISS
UniRef100_G7KNI3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aldehyde dehydrogenase n=1 Tax=Medicago truncatula RepID=G7KNI3_MEDTR SoyBaseE_val: 5.00E-34ISS
UniRef100_I1L4G9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L4G9_SOYBN SoyBaseE_val: 2.00E-38ISS

Expression Patterns of Glyma19g05400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05400 not represented in the dataset
Glyma19g05400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g05400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g05400
>Glyma19g05400.1   sequence type=CDS   gene model=Glyma19g05400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGAGAAGTTTGTGCTGCAGGCTCCCGCGTACTTGTTCAGGAAGGGATCTATGATGAATTTGAGAAGAGGTTGGCAGAGAAGGCAAAAGCTTGGGTTGTTGGGGATCCCTTTGATCCTAATGTTCAGCAAGGGCCTCAGGATCCTCCTCTAGTGACTTACATTACAACTTGCTATGGTAGAGAAGAGGCCACCCTTTTGACAGGGGGCAAAAGAGTGGGTAACAAGGGTTACTACATTGAGCCAACAATTTTCTCCAAT
Predicted protein sequences of Glyma19g05400
>Glyma19g05400.1   sequence type=predicted peptide   gene model=Glyma19g05400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GEVCAAGSRVLVQEGIYDEFEKRLAEKAKAWVVGDPFDPNVQQGPQDPPLVTYITTCYGREEATLLTGGKRVGNKGYYIEPTIFSN






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo