|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G55770 | AT | Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein | chr3:20703799-20704614 FORWARD LENGTH=127 | SoyBase | E_val: 7.00E-23 | ISS |
GO:0006623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole | SoyBase | N/A | ISS |
GO:0048573 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering | SoyBase | N/A | ISS |
GO:0051017 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly | SoyBase | N/A | ISS |
GO:0051049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transport | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0015629 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton | SoyBase | N/A | ISS |
GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
GO:0051015 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: actin filament binding | SoyBase | N/A | ISS |
UniRef100_F4IY33 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: GATA type zinc finger transcription factor-like protein n=1 Tax=Arabidopsis thaliana RepID=F4IY33_ARATH | SoyBase | E_val: 3.00E-20 | ISS |
UniRef100_I1LMM9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LMM9_SOYBN | SoyBase | E_val: 3.00E-23 | ISS |
Glyma19g05310 not represented in the dataset |
Glyma19g05310 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.19g039800 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g05310.1 sequence type=CDS gene model=Glyma19g05310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTGAGCAACTATTCCTCAATGGAAGGTGTTCTATATTGTAAGCCTCACTTTGAGCAGCTCTTCAAGGAGAGTGGGTCCTTCAGCAAGAACTTCCAGTCACCTGCAAAGCTAGCTGATAAGACAACACATGAGCTGGTAAAATGCTTAATTTTGCAAATTTCTAACTTATATATATATATATATATGTTGCATAAGTTCATTATTTTTTGCACGCTCTTGCTCAGAGTGCACCATTATTGA
>Glyma19g05310.1 sequence type=predicted peptide gene model=Glyma19g05310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LSNYSSMEGVLYCKPHFEQLFKESGSFSKNFQSPAKLADKTTHELVKCLILQISNLYIYIYMLHKFIIFCTLLLRVHHY*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||