SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g05310

Feature Type:gene_model
Chromosome:Gm19
Start:5749647
stop:5749984
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g05310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55770AT Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein | chr3:20703799-20704614 FORWARD LENGTH=127 SoyBaseE_val: 7.00E-23ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0051017GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly SoyBaseN/AISS
GO:0051049GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0015629GO-cc Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0051015GO-mf Annotation by Michelle Graham. GO Molecular Function: actin filament binding SoyBaseN/AISS
UniRef100_F4IY33UniRef Annotation by Michelle Graham. Most informative UniRef hit: GATA type zinc finger transcription factor-like protein n=1 Tax=Arabidopsis thaliana RepID=F4IY33_ARATH SoyBaseE_val: 3.00E-20ISS
UniRef100_I1LMM9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LMM9_SOYBN SoyBaseE_val: 3.00E-23ISS

Expression Patterns of Glyma19g05310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g039800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g05310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g05310
>Glyma19g05310.1   sequence type=CDS   gene model=Glyma19g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGAGCAACTATTCCTCAATGGAAGGTGTTCTATATTGTAAGCCTCACTTTGAGCAGCTCTTCAAGGAGAGTGGGTCCTTCAGCAAGAACTTCCAGTCACCTGCAAAGCTAGCTGATAAGACAACACATGAGCTGGTAAAATGCTTAATTTTGCAAATTTCTAACTTATATATATATATATATATGTTGCATAAGTTCATTATTTTTTGCACGCTCTTGCTCAGAGTGCACCATTATTGA
Predicted protein sequences of Glyma19g05310
>Glyma19g05310.1   sequence type=predicted peptide   gene model=Glyma19g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LSNYSSMEGVLYCKPHFEQLFKESGSFSKNFQSPAKLADKTTHELVKCLILQISNLYIYIYMLHKFIIFCTLLLRVHHY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo