Glyma19g05180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g05180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g05180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g05180

Feature Type:	gene_model
Chromosome:	Gm19
Start:	5514800
stop:	5516321
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g05180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08500	AT	Annotation by Michelle Graham. TAIR10: Transmembrane CLPTM1 family protein \| chr5:2748261-2751590 FORWARD LENGTH=590	SoyBase	E_val: 3.00E-29	ISS
GO:0007062	GO-bp	Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion	SoyBase	N/A	ISS
GO:0007129	GO-bp	Annotation by Michelle Graham. GO Biological Process: synapsis	SoyBase	N/A	ISS
GO:0007131	GO-bp	Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0010332	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gamma radiation	SoyBase	N/A	ISS
GO:0032204	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance	SoyBase	N/A	ISS
GO:0032504	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction	SoyBase	N/A	ISS
GO:0033044	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization	SoyBase	N/A	ISS
GO:0042138	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation	SoyBase	N/A	ISS
GO:0043247	GO-bp	Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage	SoyBase	N/A	ISS
GO:0045132	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation	SoyBase	N/A	ISS
PF05602	PFAM	Cleft lip and palate transmembrane protein 1 (CLPTM1)	JGI		ISS
UniRef100_G7J2P6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cleft lip and palate transmembrane protein-like protein n=1 Tax=Medicago truncatula RepID=G7J2P6_MEDTR	SoyBase	E_val: 1.00E-35	ISS
UniRef100_I1N6I9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N6I9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g05180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05180 not represented in the dataset	Glyma19g05180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g05180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g05180

Limit To All Plant Sequences

>Glyma19g05180.1   sequence type=CDS   gene model=Glyma19g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCAGTAGCAACAGCGCAAGGAGGGTTTGGCCTCTCTGGAATCATATGTATGGTAGTTTTTTGGTACTTCGCCTCCAAATTCTTTTCCCCCAAAAAACCTACCGAACCTTCCGCTCTCATCTCCAATCTATTTCAGAAGGCACAACCTCTAGTAGGTTATGATTTGAGTTTGAATGGAATTTCAATTTCGAGTTATGAAGTTATGATGGCACGTGATTACTTTTTTCCTAGTTGGAGCATAATAGGAGTCTATATGCTCATGTTTTCTTTGCACACTCTGGCTTTTCGCACCCAAAAAGTGGCTTACGAGACGTCTTCATTTTTGTTGGTCTCAACTGTTGTGATGTACTTGCCCAAGTCACAAGCAGATAAAAAGAAAAGTCTGTTGGGAAGTTCACCAGATTTTAGTGAGGCTCAAGTGACATCCAAGGTGGTTGATGAATCTGAAGATGATAATGATTCTAATGATGATGGTTCTGTGGAGTGGGCTTCATATTGGAAACCAAATATAACAATAAACTTGGTTGCTGACTTCACTCAGTATCTTTCTTGGAATTCATTTAATTTGGTGGCACATTTTTTAACTATATTTTTGCATGAAGTAGTATCGGAGGGATGGTTGGAAATATTTATGCATCTTGGAGGTTACATACTAGCTTTTGGCATGCTTCTATTTTTCTTGTTCACCATGTTCAAGTTTTTAACCATGTCCTTATTTAATAGGGTTGTATATGAGGAATTGGGGAAATATGGAGATGTGGATAACCAACTTTTGTGCCGTGAGCGA

Predicted protein sequences of Glyma19g05180

Limit To All Plant Sequences

>Glyma19g05180.1   sequence type=predicted peptide   gene model=Glyma19g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AVATAQGGFGLSGIICMVVFWYFASKFFSPKKPTEPSALISNLFQKAQPLVGYDLSLNGISISSYEVMMARDYFFPSWSIIGVYMLMFSLHTLAFRTQKVAYETSSFLLVSTVVMYLPKSQADKKKSLLGSSPDFSEAQVTSKVVDESEDDNDSNDDGSVEWASYWKPNITINLVADFTQYLSWNSFNLVAHFLTIFLHEVVSEGWLEIFMHLGGYILAFGMLLFFLFTMFKFLTMSLFNRVVYEELGKYGDVDNQLLCRER

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain