SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g05180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g05180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g05180

Feature Type:gene_model
Chromosome:Gm19
Start:5514800
stop:5516321
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08500AT Annotation by Michelle Graham. TAIR10: Transmembrane CLPTM1 family protein | chr5:2748261-2751590 FORWARD LENGTH=590 SoyBaseE_val: 3.00E-29ISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0032504GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
PF05602PFAM Cleft lip and palate transmembrane protein 1 (CLPTM1) JGI ISS
UniRef100_G7J2P6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cleft lip and palate transmembrane protein-like protein n=1 Tax=Medicago truncatula RepID=G7J2P6_MEDTR SoyBaseE_val: 1.00E-35ISS
UniRef100_I1N6I9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N6I9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05180 not represented in the dataset

Glyma19g05180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g05180.1   sequence type=CDS   gene model=Glyma19g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCAGTAGCAACAGCGCAAGGAGGGTTTGGCCTCTCTGGAATCATATGTATGGTAGTTTTTTGGTACTTCGCCTCCAAATTCTTTTCCCCCAAAAAACCTACCGAACCTTCCGCTCTCATCTCCAATCTATTTCAGAAGGCACAACCTCTAGTAGGTTATGATTTGAGTTTGAATGGAATTTCAATTTCGAGTTATGAAGTTATGATGGCACGTGATTACTTTTTTCCTAGTTGGAGCATAATAGGAGTCTATATGCTCATGTTTTCTTTGCACACTCTGGCTTTTCGCACCCAAAAAGTGGCTTACGAGACGTCTTCATTTTTGTTGGTCTCAACTGTTGTGATGTACTTGCCCAAGTCACAAGCAGATAAAAAGAAAAGTCTGTTGGGAAGTTCACCAGATTTTAGTGAGGCTCAAGTGACATCCAAGGTGGTTGATGAATCTGAAGATGATAATGATTCTAATGATGATGGTTCTGTGGAGTGGGCTTCATATTGGAAACCAAATATAACAATAAACTTGGTTGCTGACTTCACTCAGTATCTTTCTTGGAATTCATTTAATTTGGTGGCACATTTTTTAACTATATTTTTGCATGAAGTAGTATCGGAGGGATGGTTGGAAATATTTATGCATCTTGGAGGTTACATACTAGCTTTTGGCATGCTTCTATTTTTCTTGTTCACCATGTTCAAGTTTTTAACCATGTCCTTATTTAATAGGGTTGTATATGAGGAATTGGGGAAATATGGAGATGTGGATAACCAACTTTTGTGCCGTGAGCGA

>Glyma19g05180.1   sequence type=predicted peptide   gene model=Glyma19g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AVATAQGGFGLSGIICMVVFWYFASKFFSPKKPTEPSALISNLFQKAQPLVGYDLSLNGISISSYEVMMARDYFFPSWSIIGVYMLMFSLHTLAFRTQKVAYETSSFLLVSTVVMYLPKSQADKKKSLLGSSPDFSEAQVTSKVVDESEDDNDSNDDGSVEWASYWKPNITINLVADFTQYLSWNSFNLVAHFLTIFLHEVVSEGWLEIFMHLGGYILAFGMLLFFLFTMFKFLTMSLFNRVVYEELGKYGDVDNQLLCRER







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo