Glyma19g05130 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g05130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g05130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g05130

Feature Type:	gene_model
Chromosome:	Gm19
Start:	5403313
stop:	5403903
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g05130

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G22370	AT	Annotation by Michelle Graham. TAIR10: UDP-glucosyl transferase 85A5 \| chr1:7898116-7899879 REVERSE LENGTH=479	SoyBase	E_val: 4.00E-34	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0015020	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glucuronosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016758	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups	SoyBase	N/A	ISS
PTHR11926	Panther	GLUCOSYL/GLUCURONOSYL TRANSFERASES	JGI		ISS
PTHR11926:SF15	Panther	UDP-GLUCURONOSYLTRANSFERASE RELATED	JGI		ISS
UniRef100_G7KM92	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytokinin-O-glucosyltransferase n=1 Tax=Medicago truncatula RepID=G7KM92_MEDTR	SoyBase	E_val: 5.00E-47	ISS
UniRef100_I1N6I5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6I5_SOYBN	SoyBase	E_val: 1.00E-85	ISS

Expression Patterns of Glyma19g05130

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g05130 not represented in the dataset	Glyma19g05130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g05130 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g038500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g05130

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g05130

Limit To All Plant Sequences

>Glyma19g05130.2   sequence type=CDS   gene model=Glyma19g05130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTCTCAGCAGAGAGAAAGCCACATGCTGTGTTCTCTCCATTTCCCATACAAGGTCATATCAACCCATTGTTTAAACTAGCAAAGCTACTTCATCTAAGAGGCTTTCACATAACCTTTGTCCACACAGAACACAATCACAAACTCTTGCTCAAATCAAGGGGTCTCAATGCCCTTGAAGACTTTTTTTGCTTTGAGAGCATCCTAGATGGTGTTCCTCCCAATAATGATGACAATCTTGATGCCACTCATCATGTAGTTTCTCTTTATTGTGCCATGACCTTTACTATAGAAGCTGCTGAAGAACTTTCACTTCCTATCCTTCTCTTTCATCCAGCTAGTGCTAGTACATTATTGTATGGTTTGCACTTTCGTACTCTGTTGGATAAAGGTCTCATACCACTCAAA

Predicted protein sequences of Glyma19g05130

Limit To All Plant Sequences

>Glyma19g05130.2   sequence type=predicted peptide   gene model=Glyma19g05130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFSAERKPHAVFSPFPIQGHINPLFKLAKLLHLRGFHITFVHTEHNHKLLLKSRGLNALEDFFCFESILDGVPPNNDDNLDATHHVVSLYCAMTFTIEAAEELSLPILLFHPASASTLLYGLHFRTLLDKGLIPLK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain