Glyma19g04836 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g04836): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g04836): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g04836

Feature Type:	gene_model
Chromosome:	Gm19
Start:	5056040
stop:	5057438
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g04836

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08510	AT	Annotation by Michelle Graham. TAIR10: phospholipase C 2 \| chr3:2582626-2585556 REVERSE LENGTH=552	SoyBase	E_val: 8.00E-43	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0030048	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament-based movement	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0051645	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi localization	SoyBase	N/A	ISS
GO:0051646	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrion localization	SoyBase	N/A	ISS
GO:0060151	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome localization	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004435	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol phospholipase C activity	SoyBase	N/A	ISS
GO:0004629	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipase C activity	SoyBase	N/A	ISS
GO:0008081	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoric diester hydrolase activity	SoyBase	N/A	ISS
PTHR10336	Panther	PHOSPHOLIPASE C-RELATED	JGI		ISS
PTHR10336:SF35	Panther	PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C FAMILY P	JGI		ISS
PF09279	PFAM	Phosphoinositide-specific phospholipase C, efhand-like	JGI		ISS
UniRef100_Q43443	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phosphoinositide-specific phospholipase C P13 n=1 Tax=Glycine max RepID=Q43443_SOYBN	SoyBase	E_val: 7.00E-71	ISS
UniRef100_UPI000233E1C0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E1C0 related cluster n=1 Tax=unknown RepID=UPI000233E1C0	SoyBase	E_val: 3.00E-86	ISS

Expression Patterns of Glyma19g04836

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g04836 not represented in the dataset	Glyma19g04836 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g04836 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g04836

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g04836

Limit To All Plant Sequences

>Glyma19g04836.1   sequence type=CDS   gene model=Glyma19g04836   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGTCAAAACAAACATACAGTGTGTGCTTCTACTGGCGGCAGTGGCTCAAGCTGGTGCTGGCGGAGGTGCCGTCAGAAATCAAGACCCTGTTCGATGAGTATTCCGAGAATGAGCTCATGACACCTTCGCATCTCAAGAGATTCTTGATCGAAAGGCAAGAGAAGGCCACTGAAGAAGACACACAAGCCATCATTAATAGGTTTAGGCATTTCCATCACAAAGGGGTTGGCCTCAATCTTGAAACTTTCTTTAAGTACCTCTTTAGTGAAGATAATCCTCCTCTTCTTCCTTCTCATGGGGTGCACCATGATATGACTTTACCCTTGTCACATTATTTCATATATACTGGCCATAATTCCTATTTAACTGGGAATTAG

Predicted protein sequences of Glyma19g04836

Limit To All Plant Sequences

>Glyma19g04836.1   sequence type=predicted peptide   gene model=Glyma19g04836   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSKQTYSVCFYWRQWLKLVLAEVPSEIKTLFDEYSENELMTPSHLKRFLIERQEKATEEDTQAIINRFRHFHHKGVGLNLETFFKYLFSEDNPPLLPSHGVHHDMTLPLSHYFIYTGHNSYLTGN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain