SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g04505

Feature Type:gene_model
Chromosome:Gm19
Start:4677953
stop:4678885
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g04505
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15780AT Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr5:5144898-5146297 REVERSE LENGTH=401 SoyBaseE_val: 4.00E-37ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_Q2HSE9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen Ole e 1 allergen and extensin n=1 Tax=Medicago truncatula RepID=Q2HSE9_MEDTR SoyBaseE_val: 2.00E-57ISS
UniRef100_UPI000233E1B9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E1B9 related cluster n=1 Tax=unknown RepID=UPI000233E1B9 SoyBaseE_val: 1.00E-108ISS

Expression Patterns of Glyma19g04505
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g04505 not represented in the dataset
Glyma19g04505 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g04505 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.U002500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g04505
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g04505
>Glyma19g04505.1   sequence type=CDS   gene model=Glyma19g04505   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTTGGTTTCTCCTAATTGTGTTTCTTAGTCTCACATATGGTAGTCTTTCAAAGGCTAGCTACGACAAGAAGCTTCCTTCTGCTATTGTGGTTGGCACTGTCTACTGCGACACATGTTTTCAACATAATTTCTCTTTAAGAAGCCATTTCATTTCAGGTGCCTCAGTGGCTGTAAAATGCAAAGTTGGGAAATCAGTACCAAGTTTCAATAAAGAAGTGAAGACAAATGAGAATGGTGAATTCAAAGTGCAACTACCATTCAAAGTGTGGAAACAAGTAAAGAGAATCAAGGGATGCACTTTCAAATTGATAAGTAGCAATGAGTCTCATTGTTCTATTGCCTCAGTTGATACCTCTTCTTCAGTGAATCTCAAGGCAATAAAACAAGGAGAACACATATTCTCAGCTGGGTTATTCTCATTCAAGCCTATAAAAAAACCAAACTTTTGCAACCAAAAACCAAGCTTTCCTCCAATCCCATTCCTACCCCCAATCCCATTTCTCCCCCCAAATCCATTTCTCCCTCCAAATCCACTTCTCCCAGCTCCAACCCCATTTCTACCTCCCCAAGTTACTAATCCATTGCAACCATTAAGCCCACCACCACTCTTCCCCCCAGTATAA
Predicted protein sequences of Glyma19g04505
>Glyma19g04505.1   sequence type=predicted peptide   gene model=Glyma19g04505   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCWFLLIVFLSLTYGSLSKASYDKKLPSAIVVGTVYCDTCFQHNFSLRSHFISGASVAVKCKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRIKGCTFKLISSNESHCSIASVDTSSSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSFPPIPFLPPIPFLPPNPFLPPNPLLPAPTPFLPPQVTNPLQPLSPPPLFPPV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo