Glyma19g04470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g04470

Feature Type:	gene_model
Chromosome:	Gm19
Start:	4646741
stop:	4647877
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g04470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G15780	AT	Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein \| chr5:5144898-5146297 REVERSE LENGTH=401	SoyBase	E_val: 1.00E-37	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF01190	PFAM	Pollen proteins Ole e I like	JGI		ISS
UniRef100_I1N6F8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6F8_SOYBN	SoyBase	E_val: 5.00E-112	ISS
UniRef100_Q2HSE9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pollen Ole e 1 allergen and extensin n=1 Tax=Medicago truncatula RepID=Q2HSE9_MEDTR	SoyBase	E_val: 2.00E-57	ISS

Expression Patterns of Glyma19g04470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g04470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g035600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g04470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g04470

Limit To All Plant Sequences

>Glyma19g04470.1   sequence type=CDS   gene model=Glyma19g04470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTTGGTTTCTCCTATTTGTGTTTCTTAGTCTCACATATGGTAGTCTTTCAGAGACTAGCTACGACAAGAAACTTCCTTCTGCTATTGTGGTTGGCACTGTCTACTGCGACGCATGTTTTCAACAGAATTTCTCTTCAAGAAGCCATTTCATTTCAGGTGCCTCAGTGGCTGTAAAATGCAAAGTTGGGAAATCAGTACCAAGTTTCAATAAAGAAGTGAAGACAAATGAGAATGGTGAATTCAAAGTGCAACTACCATTCAAAGTGTGGAAACAAGTAAAGAGAATCAAGGGATGCACTTTCAAATTGATAAGTAGCAATGAGCCTCATTGTTCTGTTGCCTCAGTTGATACCTCTTCTTCAGTGAATCTCAAGGCAATAAAACAAGGAGAACACATATTCTCAGCTGGGTTATTCTCATTCAAGCCTATAAAAAAACCAAACTTTTGCAACCAAAAACCAAGTGTTCCAAATTCAAAGGCACATGATACCTTTTTCCCTTTCCCTCCAATCCCATTTCTACCTCCAATCCCTTTTCTTCCACCAATCCAGTTTCCTCCAATCCCATTCCTACCCCCAATCCCATTTCTCCCCCCAAATCCATTTCTCCCTCCAAATCCACTTCTCCCAGCTCCAACCCCATTTCTACCTCCCCAAGTTACTAATCCATTGCAACCATTAAGCCCACCACCACTCTTCCCCCCAGTATAA

Predicted protein sequences of Glyma19g04470

Limit To All Plant Sequences

>Glyma19g04470.1   sequence type=predicted peptide   gene model=Glyma19g04470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCWFLLFVFLSLTYGSLSETSYDKKLPSAIVVGTVYCDACFQQNFSSRSHFISGASVAVKCKVGKSVPSFNKEVKTNENGEFKVQLPFKVWKQVKRIKGCTFKLISSNEPHCSVASVDTSSSVNLKAIKQGEHIFSAGLFSFKPIKKPNFCNQKPSVPNSKAHDTFFPFPPIPFLPPIPFLPPIQFPPIPFLPPIPFLPPNPFLPPNPLLPAPTPFLPPQVTNPLQPLSPPPLFPPV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain