Glyma19g04441 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g04441

Feature Type:	gene_model
Chromosome:	Gm19
Start:	4622316
stop:	4624030
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g04441

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G72650	AT	Annotation by Michelle Graham. TAIR10: TRF-like 6 \| chr1:27350253-27353483 FORWARD LENGTH=630	SoyBase	E_val: 2.00E-23	ISS
GO:0000956	GO-bp	Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0010048	GO-bp	Annotation by Michelle Graham. GO Biological Process: vernalization response	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_E4W6A0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor MYB884 n=1 Tax=Glycine max RepID=E4W6A0_SOYBN	SoyBase	E_val: 7.00E-161	ISS
UniRef100_UPI000233E1B6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E1B6 related cluster n=1 Tax=unknown RepID=UPI000233E1B6	SoyBase	E_val: 8.00E-180	ISS

Expression Patterns of Glyma19g04441

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g04441 not represented in the dataset	Glyma19g04441 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g04441 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g035300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g04441

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g04441

Limit To All Plant Sequences

>Glyma19g04441.1   sequence type=CDS   gene model=Glyma19g04441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGGTGTGGACGATGAAATGGTGAGCAAATTACAGATTTTGCAAAAGGTCAAAGAGGAGAAACAACGCATATCATGTGGATCACCTGCTCATTCTCATGTAAATATAGACAGCCAGTGTTCAGCTGATAAATTTCCAGTCATGGATGGGAAGGTTCAATCTGAAACTCCCTGCCAGGAAATTCCTTCTATAGCATCAAGTTTAAATTATACTCATAGTAATCAATCTGGGAGTATTGATCAGTGTTCCAGACCTTCAGAAGGAGTAATAGAGAGTGGATCATCTGCTTCTGCTGTCTATTCCAATTTAAAGCTTGATCTTTCAATGTCAGATGGAGAAATATGCTTGGACAAGCTATCAATCAGAGAACTGCATGAACTATTTAAGGTAACATTTGGTCGGGAAACCACTGTTAAAGACAAACAGTGGCTGAAAAGGAGGATTGCCATGAGTTTAACTAATTCGTGTGATGTTTCAGCTACAACTTTCATTATTAAAAATAACAAAATAGTTAGAAAATTTGAAGAAGAAAGTTCTGGAAATATGAATGCTGGATCTTTAATCTCTTCGGGAAATATGACTGAAGAAGAAGATGTCAACTTTAAGGATTCATCTGCTGTAAATGCTTGTGGAATTGAAGATAACCAAGTTGTTTCTGAAACAAGACCAAAAATTGGATTGGAAGATGAGAATTATCAAACAGGACAAAGAGCTGCAAAGACAAATTGCATGAACATA

Predicted protein sequences of Glyma19g04441

Limit To All Plant Sequences

>Glyma19g04441.1   sequence type=predicted peptide   gene model=Glyma19g04441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMGVDDEMVSKLQILQKVKEEKQRISCGSPAHSHVNIDSQCSADKFPVMDGKVQSETPCQEIPSIASSLNYTHSNQSGSIDQCSRPSEGVIESGSSASAVYSNLKLDLSMSDGEICLDKLSIRELHELFKVTFGRETTVKDKQWLKRRIAMSLTNSCDVSATTFIIKNNKIVRKFEEESSGNMNAGSLISSGNMTEEEDVNFKDSSAVNACGIEDNQVVSETRPKIGLEDENYQTGQRAAKTNCMNI

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain