SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g04390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g04390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g04390

Feature Type:gene_model
Chromosome:Gm19
Start:4578747
stop:4581628
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g04390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15520AT Annotation by Michelle Graham. TAIR10: pleiotropic drug resistance 12 | chr1:5331993-5338175 REVERSE LENGTH=1423 SoyBaseE_val: 3.00E-77ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006855GO-bp Annotation by Michelle Graham. GO Biological Process: drug transmembrane transport SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010193GO-bp Annotation by Michelle Graham. GO Biological Process: response to ozone SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015692GO-bp Annotation by Michelle Graham. GO Biological Process: lead ion transport SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0046865GO-bp Annotation by Michelle Graham. GO Biological Process: terpenoid transport SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0080168GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
GO:0042626GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances SoyBaseN/AISS
PTHR19241Panther ATP-BINDING CASSETTE TRANSPORTER JGI ISS
PTHR19241:SF95Panther JGI ISS
PF00005PFAM ABC transporter JGI ISS
UniRef100_G7KXE7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pleiotropic drug resistance ABC transporter family protein n=1 Tax=Medicago truncatula RepID=G7KXE7_MEDTR SoyBaseE_val: 6.00E-84ISS
UniRef100_I1JP88UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JP88_SOYBN SoyBaseE_val: 7.00E-87ISS

Expression Patterns of Glyma19g04390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g04390 not represented in the dataset
Glyma19g04390 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g04390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g04390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g04390
>Glyma19g04390.1   sequence type=CDS   gene model=Glyma19g04390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACAAAGTGGAATTTCAATTATGGCAGAGGAACCTCAAGTGCAATTAAGTCATTCTTTTTCAAAGGAACATAAGAGTTTTGGGCCAGTTACTGGTTGTCCAAGACAACCATGGCATGATTTGCATTCCCAAGTTGATGGTCCAGCAACATATGACATTCTCACCAATTTTGAGGAGCGTTGGTTAAGGGCATTAAAAATGCATAGATATCAAAAGATGAGAAGTTCACATGATGATTCATTACTGAAAATTGATAGAATCCCTGACATTGTTGGCATTGATGAAGTTCCTTGCCAGAATGAAAATAACCGGGAGACTTGGCATGTCCAGGAAAATGCTAATTCCGTTTACTTCATTGAACAGAACTTGGTTTGTGGAAAGAATGTACTGATAGACATGAGCATACATTCAGCGTATGTCAAAGCAAATCGAGCAGCCCAAAAGTTTATCTATATTGAGAACCAATACTTTCTTGGCTCAATGACATTGCTTTTGGGCCCTCCATGTTCCGGAAAAACCACCCTCTTGTTGGTCTTGGGTGCAAAACTTGATCCAAAATTAAAGTTTTCTGGAAAGGTGACTTATAATGGTCGTGGGATGGATGAGTTTGTACCCCAAAAAACTGCTGCTTATGCCAATCAAAATGATCTTCATGTTGCAGAGTTGACAGTCAGAGAAACCTTGGCCTTCTCAGCAAGAGTCCAAGGAGTTGGAACTCGTTATGATTTGCTTGCAGAATTGTCCAGAAGAGAAAAAGAGACAAATATCAAGCCTAATCAAGATATTGATGTCTACATGAAGAAGGAAAATTTGATGACAGATTATGTCTTAAGGATTTTAGGACTGGAGGTCTGTGCTGATACTATTGTACGAAATGCAATGTTAAGGGGGATATCTGGTGGACAAAGGAAACGTGTTACAACAGGGGAGATGCTGGTTGGACCAACTAATGCTTTATTCATGGATGAAATATCTATTGCTCAACAACTTACTGTTCCCTCTTGCATTTTAATGATATGCTTGTGTGATGCTACTAAAAAATTTTCAGGGGTCAGAAAGACTTTGAATTCAGAGTTATGGCATGCTTTTGCAGGGCTTCTTGTGTCATTACCCCAAGTTGGGAGTCTTGTGTTTTACTTCCCTCAGGGACATAGTGAGCAGGTGAATGAATCTGTTGTTCTCTTTTCA
Predicted protein sequences of Glyma19g04390
>Glyma19g04390.1   sequence type=predicted peptide   gene model=Glyma19g04390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQSGISIMAEEPQVQLSHSFSKEHKSFGPVTGCPRQPWHDLHSQVDGPATYDILTNFEERWLRALKMHRYQKMRSSHDDSLLKIDRIPDIVGIDEVPCQNENNRETWHVQENANSVYFIEQNLVCGKNVLIDMSIHSAYVKANRAAQKFIYIENQYFLGSMTLLLGPPCSGKTTLLLVLGAKLDPKLKFSGKVTYNGRGMDEFVPQKTAAYANQNDLHVAELTVRETLAFSARVQGVGTRYDLLAELSRREKETNIKPNQDIDVYMKKENLMTDYVLRILGLEVCADTIVRNAMLRGISGGQRKRVTTGEMLVGPTNALFMDEISIAQQLTVPSCILMICLCDATKKFSGVRKTLNSELWHAFAGLLVSLPQVGSLVFYFPQGHSEQVNESVVLFS






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo