|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G26310 | AT | Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr1:9100330-9103510 REVERSE LENGTH=255 | SoyBase | E_val: 3.00E-30 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0009911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development | SoyBase | N/A | ISS |
| GO:0010048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vernalization response | SoyBase | N/A | ISS |
| GO:0010582 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy | SoyBase | N/A | ISS |
| GO:0043481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light | SoyBase | N/A | ISS |
| GO:0048440 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carpel development | SoyBase | N/A | ISS |
| GO:0048443 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stamen development | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0046983 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity | SoyBase | N/A | ISS |
| PTHR11945 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PTHR11945:SF19 | Panther | MADS BOX PROTEIN | JGI | ISS | |
| PF00319 | PFAM | SRF-type transcription factor (DNA-binding and dimerisation domain) | JGI | ISS | |
| UniRef100_D2T2G0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: GSQUA2 protein n=1 Tax=Gerbera hybrid cultivar RepID=D2T2G0_GERHY | SoyBase | E_val: 2.00E-29 | ISS |
| UniRef100_UPI000233B273 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233B273 related cluster n=1 Tax=unknown RepID=UPI000233B273 | SoyBase | E_val: 4.00E-35 | ISS |
|
Glyma19g04326 not represented in the dataset |
Glyma19g04326 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g04326.1 sequence type=CDS gene model=Glyma19g04326 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGGAGAGGAAGGGTTCAGCTGAAGCAGATCGAGAACAAAATCAGCCGCCAAGTGACGTTTTCCAAAAGGAGAACTGGGCTGCGAAAGAAAGCTAATGAAATCTCTGTGCTCTGTGATGCTCAAGTGGCACTGATTGTGTTCAATGCTAAAGGGAAGCTTTTTGAGTATTCTTCTGAATCCAGCTTGCTTCAAAGTCAAAATAAAATAGTACTCAGGAATGTTTTAAATTGTGCGGCCGTGATTACAATTTCGTCGCAATCTTTGTGA
>Glyma19g04326.1 sequence type=predicted peptide gene model=Glyma19g04326 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGRGRVQLKQIENKISRQVTFSKRRTGLRKKANEISVLCDAQVALIVFNAKGKLFEYSSESSLLQSQNKIVLRNVLNCAAVITISSQSL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||