SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g04150

Feature Type:gene_model
Chromosome:Gm19
Start:4244700
stop:4245728
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g04150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51550AT Annotation by Michelle Graham. TAIR10: Malectin/receptor-like protein kinase family protein | chr3:19117877-19120564 REVERSE LENGTH=895 SoyBaseE_val: 2.00E-26ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009791GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic development SoyBaseN/AISS
GO:0010193GO-bp Annotation by Michelle Graham. GO Biological Process: response to ozone SoyBaseN/AISS
GO:0010483GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube reception SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0043680GO-cc Annotation by Michelle Graham. GO Cellular Compartment: filiform apparatus SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
UniRef100_C6ZRM1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like kinase n=2 Tax=Glycine max RepID=C6ZRM1_SOYBN SoyBaseE_val: 2.00E-91ISS
UniRef100_C6ZRM1UniRef Annotation by Michelle Graham. Best UniRef hit: Receptor-like kinase n=2 Tax=Glycine max RepID=C6ZRM1_SOYBN SoyBaseE_val: 2.00E-91ISS

Expression Patterns of Glyma19g04150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g04150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g04150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g04150
>Glyma19g04150.1   sequence type=CDS   gene model=Glyma19g04150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGCAATTGACACTGTATTCACGCTTGTGGGACACGACATGCTGTTCAGCATTGAAAGCATTGCTGCACTGGAGACGGTGTATAGAATTCAAGTCCGAGGGCACGAAATCTCTCCACAAAGCGACACCGCTAACACGGATGGTAAGATGAACATAACCGTGAATCCTGATCATGTGGCGCCCAAGGAACTGTACAGAACAGCCCATAACATGGGCACAAACACCACTCTGAACATAATCAGCAACCTGACTTGGGAGTTTCCCGTTGATGCTGGCTTCACTTACGTGCTCAGGTTTCACTTTTGGGAGCTTGACCCCAATCTTGATATAGACGGTGACAGGGTGTTCTTCATTTACATAGCAAGCCACTTGGTTGATGATCGCGCTGATGTTATGAGATGGACACAGAAACAGAAAAGGTTTCTCCGCGTATAA
Predicted protein sequences of Glyma19g04150
>Glyma19g04150.1   sequence type=predicted peptide   gene model=Glyma19g04150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAIDTVFTLVGHDMLFSIESIAALETVYRIQVRGHEISPQSDTANTDGKMNITVNPDHVAPKELYRTAHNMGTNTTLNIISNLTWEFPVDAGFTYVLRFHFWELDPNLDIDGDRVFFIYIASHLVDDRADVMRWTQKQKRFLRV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo