SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g03745

Feature Type:gene_model
Chromosome:Gm19
Start:3758553
stop:3758913
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g03745
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G43780AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 30 Blast hits to 30 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 30; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:18136444-18136647 REVERSE LENGTH=67 SoyBaseE_val: 8.00E-21ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q2QMA7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa Japonica Group RepID=Q2QMA7_ORYSJ SoyBaseE_val: 4.00E-17ISS
UniRef100_UPI000233DED2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DED2 related cluster n=1 Tax=unknown RepID=UPI000233DED2 SoyBaseE_val: 2.00E-40ISS

Expression Patterns of Glyma19g03745
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g03745 not represented in the dataset
Glyma19g03745 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g03745 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g030600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g03745
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g03745
>Glyma19g03745.1   sequence type=CDS   gene model=Glyma19g03745   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGAATTTTGGGATATAGGAGCCTTCCACCTAAGGCAAAGAATTTGGTTGTTGGGGGTTTGATAGCTTTTGTCTTTGGTGCCTACTTTTACACCATGAGGGTTGTTGGAGGCACTAATGAACTGCAGGTAGCAATTGATAAGTTTGAAGTTGACAAGAACAAGAATGCGGGTGATGCCAACATGCCATCAAAGGTCTAA
Predicted protein sequences of Glyma19g03745
>Glyma19g03745.1   sequence type=predicted peptide   gene model=Glyma19g03745   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARILGYRSLPPKAKNLVVGGLIAFVFGAYFYTMRVVGGTNELQVAIDKFEVDKNKNAGDANMPSKV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo