SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g03690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g03690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g03690

Feature Type:gene_model
Chromosome:Gm19
Start:3704265
stop:3706070
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g03690
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G39210AT Annotation by Michelle Graham. TAIR10: chlororespiratory reduction 7 | chr5:15703231-15703999 FORWARD LENGTH=156 SoyBaseE_val: 4.00E-40ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010275GO-bp Annotation by Michelle Graham. GO Biological Process: NAD(P)H dehydrogenase complex assembly SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0010598GO-cc Annotation by Michelle Graham. GO Cellular Compartment: NAD(P)H dehydrogenase complex (plastoquinone) SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12095PFAM Protein of unknown function (DUF3571) JGI ISS
UniRef100_I1N6B9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N6B9_SOYBN SoyBaseE_val: 1.00E-91ISS
UniRef100_Q9FL87UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlororespiratory reduction 7 n=1 Tax=Arabidopsis thaliana RepID=Q9FL87_ARATH SoyBaseE_val: 2.00E-37ISS

Expression Patterns of Glyma19g03690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g03690 not represented in the dataset
Glyma19g03690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g03690 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g030200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g03690
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g03690
>Glyma19g03690.2   sequence type=CDS   gene model=Glyma19g03690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGGTGTTTTGCAGTCTCAGCCCTTCAATGTTGGAGTTCGTTCCCTCATCTCTGCAGAAAGTTACTATATTCAGAATCGCTTAGTCTATATAACATCACCAGGCATAGTTAAATGTTTTAGTTCTTCAATCCATCAGAGACTGCCTCGAGTTACAGGTGATTGCAGAAGTAAAACTAAGGTTTTTGCATTGAGGCGGAGAAGAAGGGCAAATGAGAGAACTGAAACGTATGTGCTACTAGAACCAGGGCAGGATGAGAGATTTGTTTCTGAGGAAGAGTTAAAGGCAACGTTGAAAGAGTTGTTGGAAAATTGGCCTGGCAAGGTTCTTCCCCCTGATCTTTCAAGATATGAGAACATTGATGATGCTGTTTCTTTCCTAGTGAGATCCGTTTGTGAACTTGAAATTGATGGAGATGTTGGCTCAATCCAATGGTATGAAGTTCGTTTGGAGTGA
Predicted protein sequences of Glyma19g03690
>Glyma19g03690.2   sequence type=predicted peptide   gene model=Glyma19g03690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGVLQSQPFNVGVRSLISAESYYIQNRLVYITSPGIVKCFSSSIHQRLPRVTGDCRSKTKVFALRRRRRANERTETYVLLEPGQDERFVSEEELKATLKELLENWPGKVLPPDLSRYENIDDAVSFLVRSVCELEIDGDVGSIQWYEVRLE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo