SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g03681

Feature Type:gene_model
Chromosome:Gm19
Start:3701109
stop:3703291
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02120AT Annotation by Michelle Graham. TAIR10: hydroxyproline-rich glycoprotein family protein | chr3:377122-377577 FORWARD LENGTH=126 SoyBaseE_val: 5.00E-19ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0051329GO-bp Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_D2DW75UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hydroxyproline-rich protein n=1 Tax=Phaseolus vulgaris RepID=D2DW75_PHAVU SoyBaseE_val: 5.00E-59ISS
UniRef100_UPI000233F48EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F48E related cluster n=1 Tax=unknown RepID=UPI000233F48E SoyBaseE_val: 1.00E-86ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g03681 not represented in the dataset

Glyma19g03681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g21530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma13g06190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g030100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g03681.1   sequence type=CDS   gene model=Glyma19g03681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAGTATCATTTTTGCTGGTGGCTTTATAGGAAGTCAAAACAGAGTAAGAAGCAAGTTAAGAGAACAAACAATCGCAAGCCTACCACAATTCGACCGTTGCAACCCTTTTTGCTCACATGGTCACTATATCTTCCACCATTTTCATATACTTCTTCCAATGCTCAAACTTCTTGTTCCAATCAACACACGTTTTCCTTGTTCCGTGGTGGCACACACTATAATCTCATGGAAAAGGAAAACATGCTCAAAACGCCTCCAAAAGTTCCAATTCAACCACAAACACCCGAACCTGAATGCAAAACACCAGCTCCAGTTCAACAACAAGACCCCAATGATCATAATAACTCCTCAAATGAATTGCACAAACCTGTTACCCCAAATCGTCTTAGAGTCCCCAAGGCTTTCAAATACCCAGAAAGATATACAAGCCCAACTGATTTGATAATGTCTCCAGTAACCAAAGGCCTTCTTGCCAGAACTAGAAGGGGTGGCGGTGCAGTGTTACCACCTGGTGGTAAAAATCAACCAAAGATTCTAGACATGCCCTTGAAGGATGTTGGTCCTATCCAGAACAAGCTTCCAATGCTGATTGACGAGAAGATCAACTCAGCTTGA

>Glyma19g03681.1   sequence type=predicted peptide   gene model=Glyma19g03681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKYHFCWWLYRKSKQSKKQVKRTNNRKPTTIRPLQPFLLTWSLYLPPFSYTSSNAQTSCSNQHTFSLFRGGTHYNLMEKENMLKTPPKVPIQPQTPEPECKTPAPVQQQDPNDHNNSSNELHKPVTPNRLRVPKAFKYPERYTSPTDLIMSPVTKGLLARTRRGGGAVLPPGGKNQPKILDMPLKDVGPIQNKLPMLIDEKINSA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo