Report for Sequence Feature Glyma19g03681
Feature Type: gene_model
Chromosome: Gm19
Start: 3701109
stop: 3703291
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g03681
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G02120 AT
Annotation by Michelle Graham. TAIR10: hydroxyproline-rich glycoprotein family protein | chr3:377122-377577 FORWARD LENGTH=126
SoyBase E_val: 5.00E-19 ISS
GO:0000226 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization
SoyBase N/A ISS
GO:0000911 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation
SoyBase N/A ISS
GO:0010583 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone
SoyBase N/A ISS
GO:0051329 GO-bp
Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_D2DW75 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Hydroxyproline-rich protein n=1 Tax=Phaseolus vulgaris RepID=D2DW75_PHAVU
SoyBase E_val: 5.00E-59 ISS
UniRef100_UPI000233F48E UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233F48E related cluster n=1 Tax=unknown RepID=UPI000233F48E
SoyBase E_val: 1.00E-86 ISS
Expression Patterns of Glyma19g03681
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g03681
Paralog Evidence Comments
Glyma01g21530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma13g06190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g03681 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g030100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g03681
Coding sequences of Glyma19g03681
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g03681.1 sequence type=CDS gene model=Glyma19g03681 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAAGTATCATTTTTGCTGGTGGCTTTATAGGAAGTCAAAACAGAGTAAGAAGCAAGTTAAGAGAACAAACAATCGCAAGCCTACCACAATTCGACCGTTGCAACCCTTTTTGCTCACATGGTCACTATATCTTCCACCATTTTCATATACTTCTTCCAATGCTCAAACTTCTTGTTCCAATCAACACACGTTTTCCTTGTTCCGTGGTGGCACACACTATAATCTCATGGAAAAGGAAAACATGCTCAAAACGCCTCCAAAAGTTCCAATTCAACCACAAACACCCGAACCTGAATGCAAAACACCAGCTCCAGTTCAACAACAAGACCCCAATGATCATAATAACTCCTCAAATGAATTGCACAAACCTGTTACCCCAAATCGTCTTAGAGTCCCCAAGGCTTTCAAATACCCAGAAAGATATACAAGCCCAACTGATTTGATAATGTCTCCAGTAACCAAAGGCCTTCTTGCCAGAACTAGAAGGGGTGGCGGTGCAGTGTTACCACCTGGTGGTAAAAATCAACCAAAGATTCTAGACATGCCCTTGAAGGATGTTGGTCCTATCCAGAACAAGCTTCCAATGCTGATTGACGAGAAGATCAACTCAGCTTGA
Predicted protein sequences of Glyma19g03681
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g03681.1 sequence type=predicted peptide gene model=Glyma19g03681 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEKYHFCWWLYRKSKQSKKQVKRTNNRKPTTIRPLQPFLLTWSLYLPPFSYTSSNAQTSCSNQHTFSLFRGGTHYNLMEKENMLKTPPKVPIQPQTPEPECKTPAPVQQQDPNDHNNSSNELHKPVTPNRLRVPKAFKYPERYTSPTDLIMSPVTKGLLARTRRGGGAVLPPGGKNQPKILDMPLKDVGPIQNKLPMLIDEKINSA*