Glyma19g03620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g03620

Feature Type:	gene_model
Chromosome:	Gm19
Start:	3677874
stop:	3689205
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g03620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02100	AT	Annotation by Michelle Graham. TAIR10: UDP-Glycosyltransferase superfamily protein \| chr3:368840-370484 REVERSE LENGTH=464	SoyBase	E_val: 3.00E-115	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008194	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016758	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups	SoyBase	N/A	ISS
KOG1192	KOG	UDP-glucuronosyl and UDP-glucosyl transferase	JGI		ISS
PTHR11926	Panther	GLUCOSYL/GLUCURONOSYL TRANSFERASES	JGI		ISS
PTHR11926:SF15	Panther	UDP-GLUCURONOSYLTRANSFERASE RELATED	JGI		ISS
PF00201	PFAM	UDP-glucoronosyl and UDP-glucosyl transferase	JGI		ISS
UniRef100_I1N6B7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N6B7_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9FUJ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: UDP-glucosyltransferase HRA25 n=1 Tax=Phaseolus vulgaris RepID=Q9FUJ6_PHAVU	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g03620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g03620

Paralog	Evidence	Comments
Glyma01g21580	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma13g06151	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g03620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g029700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g03620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g03620

Limit To All Plant Sequences

>Glyma19g03620.1   sequence type=CDS   gene model=Glyma19g03620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAGACTCTCACAAAAGTTGGTCGAAAATGGATGCAAAGTCATTGTTGTGAACACAGATTACGACCACAAGCGAGTGGTGAGTTCCATGGGCGAGCAACAACATAGCCTTGATGAATCACTACTGAAGTTTGTCTCAATCCCCGATGGTTTAGGACCAGATGATGACAGAAACGATATGGGCAAGGTTGGTGAAGCTATGATGAACATCTGGCCACCTATGCTTGAGAAGCTCATAGAGGATATACATTTGAAGGGTGACAATAGAATCAGCTTAATTATTGCAGAATTGTGCATGGGATGGGCCTTGGATGTTGGGACTAAATTTGGAATCAAAGGGACCCTATTGTGGCCTGCATCAGCAGCTTTATTTGCCCTTGTATACAACCTCCCTAAGCTTATTGATGATGGGATCATAGATTCTGATGGTGGATTAACACCAACCACTAAAAAGACCATTCACATATCACAAGGTATGGCTGAGATGGACCCGGAAACCTTTTTTTGGTTTAATATGGGTGACACAGTAAACAGAACGACAGTACTGAAATATTTGATGCAGTGTACACAAAGACTGAATTTAGCGGAATGGTGGCTTTGCAACACCGCAAATGAACTTGAAGATGGGCCATTATCCTCTATTCCTAAGCTTGTACCAATTGGTCCATTGTTGACAAGTCATGATGATACAATTGCAACTACAAAATCAATTGGACAATATTGGGAAGAAGATCTCTCTTGCATGAGTTGGCTCGATCAACAACCTCGTGATTCTGTGTTGTATGTTGCCTTTGGTAGTTTCACTCATTTTGATCAAAACCAATTCAACGAACTAGCTCTTGGATTGGACCTCACCAATAGACCTTTTCTTTGGGTTGTGCGTCAAGACAATAAGAGGGTATACCCTAATGAATTCTTGGGAAGTAAAGGTAAGATTGTTGGTTGGGCTCCTCAACAAAAGGTGTTAAGCCACCCTGCTGTAGCATGTTTTGTCACCCATTGTGGTTGGAATTCTATCTTGGAAGGGTTGTCTAATGGGGTTCCTTTCTTGTGTTTGCCATATGTGGGAGACCACATTTATAACAAAACATATATTTGTGATGAGTTGAAGGTTGGGTTGGGCTTTGACTCAGAAAAAAATGGACTTGTGTCACGCATGGAGTTAAAAAGGAAAGTGGAGCACCTCCTTAGTGATGAGAACATGAAATCAAGGTCTCTGGAGTTGAAGGAGAAAGTCATGAACACCATAGCCGAAGGAGGTCAATCTTTGGAGAACCTTAATAGTTTTGTCAAGTGGGTTAAAGAATTAGGATCGACATTTTATGCATAA

Predicted protein sequences of Glyma19g03620

Limit To All Plant Sequences

>Glyma19g03620.1   sequence type=predicted peptide   gene model=Glyma19g03620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMRLSQKLVENGCKVIVVNTDYDHKRVVSSMGEQQHSLDESLLKFVSIPDGLGPDDDRNDMGKVGEAMMNIWPPMLEKLIEDIHLKGDNRISLIIAELCMGWALDVGTKFGIKGTLLWPASAALFALVYNLPKLIDDGIIDSDGGLTPTTKKTIHISQGMAEMDPETFFWFNMGDTVNRTTVLKYLMQCTQRLNLAEWWLCNTANELEDGPLSSIPKLVPIGPLLTSHDDTIATTKSIGQYWEEDLSCMSWLDQQPRDSVLYVAFGSFTHFDQNQFNELALGLDLTNRPFLWVVRQDNKRVYPNEFLGSKGKIVGWAPQQKVLSHPAVACFVTHCGWNSILEGLSNGVPFLCLPYVGDHIYNKTYICDELKVGLGFDSEKNGLVSRMELKRKVEHLLSDENMKSRSLELKEKVMNTIAEGGQSLENLNSFVKWVKELGSTFYA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain