|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G14570 | AT | Annotation by Michelle Graham. TAIR10: acylaminoacyl-peptidase-related | chr4:8362586-8366525 FORWARD LENGTH=764 | SoyBase | E_val: 3.00E-19 | ISS |
GO:0006508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteolysis | SoyBase | N/A | ISS |
GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0008236 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity | SoyBase | N/A | ISS |
GO:0070009 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: serine-type aminopeptidase activity | SoyBase | N/A | ISS |
UniRef100_G7ZZS5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Acylamino-acid-releasing enzyme n=1 Tax=Medicago truncatula RepID=G7ZZS5_MEDTR | SoyBase | E_val: 2.00E-19 | ISS |
UniRef100_UPI000233C20F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C20F related cluster n=1 Tax=unknown RepID=UPI000233C20F | SoyBase | E_val: 1.00E-22 | ISS |
Glyma19g03550 not represented in the dataset |
Glyma19g03550 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.19g028900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g03550.1 sequence type=CDS gene model=Glyma19g03550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTTACACTCTTAGTTTTATTGTGGTATCTGTACTTGCATAATAGAATACCTATTGTTGAACTTCACAATTTATGTGTCAAACTATTCTTACTTTTATGTCTTACTGTGTATGCTCGGGTTTTAAGGGAGAAAGGAATACAGGTTAAGGTCATTGTGTTTCCAAATGATGTTCATGGAATTGAAAGGCCACAATCCGACTTTGAAAGCTACCTTAACATTGTCATGTGGTTCAACAAGTATTGCAAATGA
>Glyma19g03550.1 sequence type=predicted peptide gene model=Glyma19g03550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFTLLVLLWYLYLHNRIPIVELHNLCVKLFLLLCLTVYARVLREKGIQVKVIVFPNDVHGIERPQSDFESYLNIVMWFNKYCK*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||