Report for Sequence Feature Glyma19g03530
Feature Type: gene_model
Chromosome: Gm19
Start: 3547351
stop: 3551580
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g03530
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G15530 AT
Annotation by Michelle Graham. TAIR10: biotin carboxyl carrier protein 2 | chr5:5038955-5040437 FORWARD LENGTH=255
SoyBase E_val: 1.00E-71 ISS
GO:0006633 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process
SoyBase N/A ISS
GO:0009317 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: acetyl-CoA carboxylase complex
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0003989 GO-mf
Annotation by Michelle Graham. GO Molecular Function: acetyl-CoA carboxylase activity
SoyBase N/A ISS
GO:0009374 GO-mf
Annotation by Michelle Graham. GO Molecular Function: biotin binding
SoyBase N/A ISS
PTHR23151 Panther
DIHYDROLIPOAMIDE ACETYL/SUCCINYL-TRANSFERASE-RELATED
JGI ISS
PTHR23151:SF25 Panther
BCCP2 (BIOTIN CARBOXYL CARRIER PROTEIN 2), BIOTIN
JGI ISS
PF00364 PFAM
Biotin-requiring enzyme
JGI ISS
UniRef100_C6TK92 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TK92_SOYBN
SoyBase E_val: 0 ISS
UniRef100_G7KMP4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Biotin carboxyl carrier protein of acetyl-CoA carboxylase n=1 Tax=Medicago truncatula RepID=G7KMP4_MEDTR
SoyBase E_val: 3.00E-111 ISS
Proteins Associated with Glyma19g03530
Locus Gene Symbol Protein Name
BCCP2 Biotin carboxyl carrier protein 2
Expression Patterns of Glyma19g03530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g03530
Paralog Evidence Comments
Glyma13g06080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g03530 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g028800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g03530
Coding sequences of Glyma19g03530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g03530.1 sequence type=CDS gene model=Glyma19g03530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCTCCTTCTCGGTCCCATGCCCCAAGTGTCCTACAACTTCTTCTTCGTCTTCTCTCCCTTTGGGGTTGAATTCTCAAAAGGTCTCATTTCAAAGTGGGTTGATCTTGAAGCCTTCTCTTTCATTCGGATCTTTGTCTGCTGAATCTGCTGCATCAAGGATTCAGTGCCTTAACAGGAAGCAATTTTCTGTTCTGAAGGCTACTAAAGTTGAAAATTCCAACTCTGCCCCTGTAACGGTCAATGGACCTACTGTTGCTTCATCAAAAGAAAACCAAGTGCATAATGGAAAACTCTCTGATACTACTATCCCAGATGAAGCTTCAATTATTGCATTCATGTCTCAAGTTTCAGACCTTGTAAAACTTGTGGATTCGAGAGATATTGTGGAACTTCAACTTAAGCAATCAGACTGTGAGCTCATGATAAGAAAAAAAGAAGCATTGCAGCCTCCACCAATTATAGCCCCAGCACCACCACCAATGCACTATGCCACTTTTCCTTCTCCGTCTTCGCCGCTACCAGCAGAAGCTGCTCCTGCTAGCTCTGCACCTCCAAAAGCAGCTCCTGCCTTGCCTTCCCCCGGAAAAGCAAGCACATCTTCTCACCCACCACTGAAATGTCCAATGGCAGGAACCTTCTATAGGAGTCCAGCACCTGGTGAACCTGCATTTGTCAAGGTGGGAGATAAAGTGAAGAAAGGCCAGGTTATTTGCATTATCGAGGCTATGAAACTGATGAATGAAATTGAGGCTGATCAGTCAGGAACAATAGCTGAGGTATTAGCTGAGGATGGGAAACCAGTCAGTGTAGACATGCCTCTTTTTGTAATAGTTCCATGA
Predicted protein sequences of Glyma19g03530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g03530.1 sequence type=predicted peptide gene model=Glyma19g03530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MASFSVPCPKCPTTSSSSSLPLGLNSQKVSFQSGLILKPSLSFGSLSAESAASRIQCLNRKQFSVLKATKVENSNSAPVTVNGPTVASSKENQVHNGKLSDTTIPDEASIIAFMSQVSDLVKLVDSRDIVELQLKQSDCELMIRKKEALQPPPIIAPAPPPMHYATFPSPSSPLPAEAAPASSAPPKAAPALPSPGKASTSSHPPLKCPMAGTFYRSPAPGEPAFVKVGDKVKKGQVICIIEAMKLMNEIEADQSGTIAEVLAEDGKPVSVDMPLFVIVP*