Glyma19g03520 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g03520

Feature Type:	gene_model
Chromosome:	Gm19
Start:	3541929
stop:	3544330
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g03520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02080	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S19e family protein \| chr3:364138-365161 REVERSE LENGTH=143	SoyBase	E_val: 3.00E-92	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3411	KOG	40S ribosomal protein S19	JGI		ISS
PTHR11710	Panther	40S RIBOSOMAL PROTEIN S19	JGI		ISS
PF01090	PFAM	Ribosomal protein S19e	JGI		ISS
UniRef100_B7FHE5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S19-1 n=1 Tax=Medicago truncatula RepID=B7FHE5_MEDTR	SoyBase	E_val: 1.00E-90	ISS
UniRef100_C6T4Z6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4Z6_SOYBN	SoyBase	E_val: 8.00E-101	ISS

Expression Patterns of Glyma19g03520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g03520

Paralog	Evidence	Comments
Glyma13g06070	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g03520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g028700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g03520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g03520

Limit To All Plant Sequences

>Glyma19g03520.1   sequence type=CDS   gene model=Glyma19g03520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACTGCGAGGACCGTGAAGGATGTTTCGCCTCACGATTTCGTGAAGGCTTATGCTTCCCACCTCAAGCGTTCCGGCAAGATGGAGCTTCCTGAGTGGACCGATATTGTAAAAACAGCAAAATTTAAGGAGTTGGCTCCATATGATCCTGACTGGTACTACATTAGGGCTGCCTCAATGGCAAGAAAGATCTATTTGAGAGGTGGTCTTGGTGTTGGTGCTTTCCAGAGGATCTATGGTGGAAGCAAAAGAAATGGAAGCCGTCCCCCACATTTCTGCAAGAGCAGCGGTGCAATTGCCAGACACATTCTGCAACAGTTGCAAAACATGAGCATTGTTGAGATTGATACAAAAGGAGGTAGGAAAATCACTTCTAGTGGTCGAAGGGATCTTGACCAAGTTGCTGGGCGGATTGTGGTTGCTGCCTGA

Predicted protein sequences of Glyma19g03520

Limit To All Plant Sequences

>Glyma19g03520.1   sequence type=predicted peptide   gene model=Glyma19g03520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATARTVKDVSPHDFVKAYASHLKRSGKMELPEWTDIVKTAKFKELAPYDPDWYYIRAASMARKIYLRGGLGVGAFQRIYGGSKRNGSRPPHFCKSSGAIARHILQQLQNMSIVEIDTKGGRKITSSGRRDLDQVAGRIVVAA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain