SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g03350

Feature Type:gene_model
Chromosome:Gm19
Start:3346467
stop:3347977
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74330AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr1:27943618-27947109 REVERSE LENGTH=699 SoyBaseE_val: 5.00E-25ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24056Panther CELL DIVISION PROTEIN KINASE JGI ISS
PTHR24056:SF77Panther JGI ISS
UniRef100_B9RLU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RLU5_RICCO SoyBaseE_val: 3.00E-28ISS
UniRef100_I1KCW0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCW0_SOYBN SoyBaseE_val: 7.00E-33ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g03350.1   sequence type=CDS   gene model=Glyma19g03350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTCTTTAAAGATTTGCCAGCGACCAGTGTACATCTGCTAAAAACTCTTCTTTCTATAGAACCATACAAACGTGGAACTGCCACATCTGCTCTATCATCAGAGTATTTCAAAACAAAACCTTATGTGTGTGACCCATCAAGCTTGCCAGTATACCCACCTAGCAAGGAAATCGATGCAAAACACAGGGAGGAATCAAGGTACAATACTATCTATAATATTGTTATTTTGATTTTCTCTAAAAAGAATAAAGAAACAGTGCAGGAAGGAAAAGAGAACCAAATTTTAAGTCGGAAGAAGAAGAAAAAATGCATCAAACACAGAATGTTAGCAGTAGCAGTACTTAGAGGAGTACGTGTAACCATCGAGCACGTGACTGCATGCATGCATAAGTTGAGCCATGCTTTGTATGAACCATGGGTTAGTTGGTTAGGTCGTTGGGTAGTTAGTTACGAAATCATTGGAATCTGTAACTGCTGA

>Glyma19g03350.1   sequence type=predicted peptide   gene model=Glyma19g03350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FFKDLPATSVHLLKTLLSIEPYKRGTATSALSSEYFKTKPYVCDPSSLPVYPPSKEIDAKHREESRYNTIYNIVILIFSKKNKETVQEGKENQILSRKKKKKCIKHRMLAVAVLRGVRVTIEHVTACMHKLSHALYEPWVSWLGRWVVSYEIIGICNC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo