SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g03350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g03350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g03350

Feature Type:gene_model
Chromosome:Gm19
Start:3346467
stop:3347977
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g03350
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74330AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr1:27943618-27947109 REVERSE LENGTH=699 SoyBaseE_val: 5.00E-25ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24056Panther CELL DIVISION PROTEIN KINASE JGI ISS
PTHR24056:SF77Panther JGI ISS
UniRef100_B9RLU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RLU5_RICCO SoyBaseE_val: 3.00E-28ISS
UniRef100_I1KCW0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCW0_SOYBN SoyBaseE_val: 7.00E-33ISS

Expression Patterns of Glyma19g03350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g03350 not represented in the dataset
Glyma19g03350 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g03350 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g03350
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g03350
>Glyma19g03350.1   sequence type=CDS   gene model=Glyma19g03350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTCTTTAAAGATTTGCCAGCGACCAGTGTACATCTGCTAAAAACTCTTCTTTCTATAGAACCATACAAACGTGGAACTGCCACATCTGCTCTATCATCAGAGTATTTCAAAACAAAACCTTATGTGTGTGACCCATCAAGCTTGCCAGTATACCCACCTAGCAAGGAAATCGATGCAAAACACAGGGAGGAATCAAGGTACAATACTATCTATAATATTGTTATTTTGATTTTCTCTAAAAAGAATAAAGAAACAGTGCAGGAAGGAAAAGAGAACCAAATTTTAAGTCGGAAGAAGAAGAAAAAATGCATCAAACACAGAATGTTAGCAGTAGCAGTACTTAGAGGAGTACGTGTAACCATCGAGCACGTGACTGCATGCATGCATAAGTTGAGCCATGCTTTGTATGAACCATGGGTTAGTTGGTTAGGTCGTTGGGTAGTTAGTTACGAAATCATTGGAATCTGTAACTGCTGA
Predicted protein sequences of Glyma19g03350
>Glyma19g03350.1   sequence type=predicted peptide   gene model=Glyma19g03350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FFKDLPATSVHLLKTLLSIEPYKRGTATSALSSEYFKTKPYVCDPSSLPVYPPSKEIDAKHREESRYNTIYNIVILIFSKKNKETVQEGKENQILSRKKKKKCIKHRMLAVAVLRGVRVTIEHVTACMHKLSHALYEPWVSWLGRWVVSYEIIGICNC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo