Report for Sequence Feature Glyma19g03350
Feature Type: gene_model
Chromosome: Gm19
Start: 3346467
stop: 3347977
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g03350
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G74330 AT
Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr1:27943618-27947109 REVERSE LENGTH=699
SoyBase E_val: 5.00E-25 ISS
GO:0006468 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein phosphorylation
SoyBase N/A ISS
GO:0006499 GO-bp
Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0004672 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase activity
SoyBase N/A ISS
GO:0004674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity
SoyBase N/A ISS
GO:0004713 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016772 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups
SoyBase N/A ISS
PTHR24056 Panther
CELL DIVISION PROTEIN KINASE
JGI ISS
PTHR24056:SF77 Panther
JGI ISS
UniRef100_B9RLU5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RLU5_RICCO
SoyBase E_val: 3.00E-28 ISS
UniRef100_I1KCW0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCW0_SOYBN
SoyBase E_val: 7.00E-33 ISS
Expression Patterns of Glyma19g03350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g03350 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma19g03350
Coding sequences of Glyma19g03350
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g03350.1 sequence type=CDS gene model=Glyma19g03350 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
TTCTTTAAAGATTTGCCAGCGACCAGTGTACATCTGCTAAAAACTCTTCTTTCTATAGAACCATACAAACGTGGAACTGCCACATCTGCTCTATCATCAGAGTATTTCAAAACAAAACCTTATGTGTGTGACCCATCAAGCTTGCCAGTATACCCACCTAGCAAGGAAATCGATGCAAAACACAGGGAGGAATCAAGGTACAATACTATCTATAATATTGTTATTTTGATTTTCTCTAAAAAGAATAAAGAAACAGTGCAGGAAGGAAAAGAGAACCAAATTTTAAGTCGGAAGAAGAAGAAAAAATGCATCAAACACAGAATGTTAGCAGTAGCAGTACTTAGAGGAGTACGTGTAACCATCGAGCACGTGACTGCATGCATGCATAAGTTGAGCCATGCTTTGTATGAACCATGGGTTAGTTGGTTAGGTCGTTGGGTAGTTAGTTACGAAATCATTGGAATCTGTAACTGCTGA
Predicted protein sequences of Glyma19g03350
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g03350.1 sequence type=predicted peptide gene model=Glyma19g03350 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
FFKDLPATSVHLLKTLLSIEPYKRGTATSALSSEYFKTKPYVCDPSSLPVYPPSKEIDAKHREESRYNTIYNIVILIFSKKNKETVQEGKENQILSRKKKKKCIKHRMLAVAVLRGVRVTIEHVTACMHKLSHALYEPWVSWLGRWVVSYEIIGICNC*