Glyma19g02940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g02940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g02940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g02940

Feature Type:	gene_model
Chromosome:	Gm19
Start:	3049370
stop:	3050629
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g02940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G44190	AT	Annotation by Michelle Graham. TAIR10: FAD/NAD(P)-binding oxidoreductase family protein \| chr3:15902004-15903402 REVERSE LENGTH=367	SoyBase	E_val: 7.00E-74	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0042744	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process	SoyBase	N/A	ISS
GO:0046482	GO-bp	Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0050660	GO-mf	Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding	SoyBase	N/A	ISS
PTHR22915	Panther	NADH DEHYDROGENASE-RELATED	JGI		ISS
PTHR22915:SF5	Panther	APOPTOSIS-INDUCING FACTOR (AIF)-LIKE MITCHONDRION-ASSOCIATED INDUCER OF DEATH (P53-RESPONSIVE GENE 3) (AMID PROTEIN)	JGI		ISS
PF07992	PFAM	Pyridine nucleotide-disulphide oxidoreductase	JGI		ISS
UniRef100_B9SD10	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Apoptosis-inducing factor, putative n=1 Tax=Ricinus communis RepID=B9SD10_RICCO	SoyBase	E_val: 5.00E-71	ISS
UniRef100_I1LKM6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LKM6_SOYBN	SoyBase	E_val: 1.00E-103	ISS

Expression Patterns of Glyma19g02940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g02940 not represented in the dataset	Glyma19g02940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g02940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g024900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g02940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g02940

Limit To All Plant Sequences

>Glyma19g02940.1   sequence type=CDS   gene model=Glyma19g02940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAAAATTTGATCAGTCCATTCTGATTATTGGAGGAGGTCCCACTGGTGTGGAACTTGCTGGAGCAAGGCTTACACTAGTGCACAAAGGAGCAAGGCTTCTGGAATTCGTAGGGGCAAAAGCCGAGGATAAGACTCTAAATTGGTTGAAATCAAAGAATGTTGTGGTCAAACTAGAGCAATCAAAGATATATCAAACTTCAAATGGAGGGACCATTGAGGCAGATTGTCATTTCTTATGTATAGGGAAACCACTTGCTTCAGCATGGCTTAAGGAAACTGTGTTGAAGAATGACTTGGATGGTCAAGGTAGGATCAAGGTAGATGAAAGATTGAGGGTCAAGGGCCGGAACAACATTTTTGCAATTGGAGATGTTACAGACATTCCGGAAATCAAGCAAGGGTTTTTGGCACAACAACAGCTTGAAGTGGTTGTGAAGAACTTAAATTTACCATTCTTGACAATAAGTGGAAGAATTCCAGGATTCATCAAGTCTAGAGATTTGTTTGTTGGTAAAACAAGAAAACAAATGGGACTCAATCCTGTACACATTTGA

Predicted protein sequences of Glyma19g02940

Limit To All Plant Sequences

>Glyma19g02940.1   sequence type=predicted peptide   gene model=Glyma19g02940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IKFDQSILIIGGGPTGVELAGARLTLVHKGARLLEFVGAKAEDKTLNWLKSKNVVVKLEQSKIYQTSNGGTIEADCHFLCIGKPLASAWLKETVLKNDLDGQGRIKVDERLRVKGRNNIFAIGDVTDIPEIKQGFLAQQQLEVVVKNLNLPFLTISGRIPGFIKSRDLFVGKTRKQMGLNPVHI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain