Glyma19g02911 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g02911

Feature Type:	gene_model
Chromosome:	Gm19
Start:	3007084
stop:	3008581
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g02911

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_B9RIW2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-protein ligase, putative n=1 Tax=Ricinus communis RepID=B9RIW2_RICCO	SoyBase	E_val: 1.00E-13	ISS
UniRef100_UPI0002338602	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338602 related cluster n=1 Tax=unknown RepID=UPI0002338602	SoyBase	E_val: 2.00E-22	ISS

Expression Patterns of Glyma19g02911

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g02911 not represented in the dataset	Glyma19g02911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g02911 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g02911

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g02911

Limit To All Plant Sequences

>Glyma19g02911.1   sequence type=CDS   gene model=Glyma19g02911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACCTTGGGGCTGGAGATTTTGGTTGAATCTGCCTCACAAGTTATTTCGAAGGTAATTAACATAATCTTTTGTTCTTTTATTCAACATGTGGATTATCTACCACAAGATTGTTCTAATAAAGAGTTCTTGAGGAGTTTGTCAGATGCTCAGGTAATTACTGCTAAAGCAGTTGGGGAAGTGGAAGATTTTGCACGAAGGTTAAATTCTGATTGGCCTGAAAGGATGCAAATTTTATCTTTGGGCCAAGACAGAAGACTAGTAACAATTTCTATGAATAGCAATGGTTCAACGCAGCTGTATACAAGTTTTGATAAAAGGTAG

Predicted protein sequences of Glyma19g02911

Limit To All Plant Sequences

>Glyma19g02911.1   sequence type=predicted peptide   gene model=Glyma19g02911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLGLEILVESASQVISKVINIIFCSFIQHVDYLPQDCSNKEFLRSLSDAQVITAKAVGEVEDFARRLNSDWPERMQILSLGQDRRLVTISMNSNGSTQLYTSFDKR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain