Glyma19g02871 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g02871): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g02871): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g02871

Feature Type:	gene_model
Chromosome:	Gm19
Start:	2878074
stop:	2879416
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g02871

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G36720	AT	Annotation by Michelle Graham. TAIR10: HVA22-like protein K \| chr4:17307769-17309668 FORWARD LENGTH=200	SoyBase	E_val: 1.00E-44	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR12300	Panther	HVA22-LIKE PROTEINS	JGI		ISS
PTHR12300:SF12	Panther	HVA22-LIKE PROTEIN	JGI		ISS
PF03134	PFAM	TB2/DP1, HVA22 family	JGI		ISS
UniRef100_Q6NLY8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein k n=1 Tax=Arabidopsis thaliana RepID=HA22K_ARATH	SoyBase	E_val: 5.00E-42	ISS
UniRef100_UPI000233DEDC	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DEDC related cluster n=1 Tax=unknown RepID=UPI000233DEDC	SoyBase	E_val: 4.00E-98	ISS

Expression Patterns of Glyma19g02871

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g02871 not represented in the dataset	Glyma19g02871 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g02871 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g024600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g02871

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g02871

Limit To All Plant Sequences

>Glyma19g02871.1   sequence type=CDS   gene model=Glyma19g02871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCGCTCGGCATGGTGGATTCAAGTGGCAAAGAGTCAACAAGCTATGCAATGAGGTCAGGGAGTTCGGCGCCGATCTCATCGAGGTCGATGAGCTCGCCTCCGTCTACGATCTCATCGGCGCCGATCTCATCGACGACATTTACCAGAGGTGGTTCGTTGGATTGAGGCTTCTCCTTTCACCCGTTACTTCCAACCTTCTTCTCCGCACAACATGCTGTTCTATAGGGCTTGCGCTTCCCGTGTATTCCACGTTTAAAGCTATTGAGAACAATGACCCATATGAGCAACAAAGGTGCCTATTGTATTGGGCAGCTTATGGTTCTTTTAGTGCTGCAGAAATGTTTGCTGAAAAATTATTTTCCTGGATTCCACTCTATTATCACATGAAGTTTGCATTTCTTGTTTGGCTACAGCTGCCCACTCTTGATGTAAGCTTAACCAAATTGCTGCACTTATTCACTTCCTGCTATGCTTTCTGA

Predicted protein sequences of Glyma19g02871

Limit To All Plant Sequences

>Glyma19g02871.1   sequence type=predicted peptide   gene model=Glyma19g02871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFARHGGFKWQRVNKLCNEVREFGADLIEVDELASVYDLIGADLIDDIYQRWFVGLRLLLSPVTSNLLLRTTCCSIGLALPVYSTFKAIENNDPYEQQRCLLYWAAYGSFSAAEMFAEKLFSWIPLYYHMKFAFLVWLQLPTLDVSLTKLLHLFTSCYAF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain