SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g02763

Feature Type:gene_model
Chromosome:Gm19
Start:2699246
stop:2700836
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g02763
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29750AT Annotation by Michelle Graham. TAIR10: receptor-like kinase in flowers 1 | chr1:10414071-10419813 REVERSE LENGTH=1006 SoyBaseE_val: 5.00E-68ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0007169GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004702GO-mf Annotation by Michelle Graham. GO Molecular Function: receptor signaling protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF698Panther JGI ISS
PF00560PFAM Leucine Rich Repeat JGI ISS
UniRef100_G7L7B9UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP-binding/protein serine/threonine kinase n=1 Tax=Medicago truncatula RepID=G7L7B9_MEDTR SoyBaseE_val: 2.00E-87ISS
UniRef100_UPI00023382C3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023382C3 related cluster n=1 Tax=unknown RepID=UPI00023382C3 SoyBaseE_val: 7.00E-120ISS

Expression Patterns of Glyma19g02763
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g02763 not represented in the dataset
Glyma19g02763 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g02763 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g023700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g02763
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g02763
>Glyma19g02763.1   sequence type=CDS   gene model=Glyma19g02763   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTCCACATTATTTGGTTAAGCTTCCTCACCTTAGACATGTTGATTTTGCTTTGAACTACCCAAGTGGTACGATCCCAAAGGAGTGGGGTTCAACAAAACTAACTAATATCTCTCTATTTGTTAATCGTATATCAGGGGAAATTCCTAAGGAGTTGGGAAGTATTACCACTCTAACTTGTAAGAACCTTGAAGCAAACCAATTTTATGGTGTTGTTCCACATGAACTTGTAAGTCTATCTAACCTAAAGACTTTGATTTTATCATCCAATAAATTGTCTGGGAAGTTACCGGTGACATTTGCTAAGTTTCAGAATTTGACAGATTTCAGGATAAGTGATAACAGTTTCAACGGAGAAATACCTAGCTTTATACAGAATTGGAAATTACTTCAAAGATTGCACGCAAGTGGACTGGAGGGACCTATCCCATCAAATATATCTCTTTTAAGTAATTTAAATCAGTTGAGGATTGGTGACATAAATGGTCCAAGTCAGGACTTTCCTATGTTAAGAAACATGACAGGAATGACAATATTGGTTCTGAGAAATTGTCATATTACTAGAGAGCTTCCTATTTACTTCTGC
Predicted protein sequences of Glyma19g02763
>Glyma19g02763.1   sequence type=predicted peptide   gene model=Glyma19g02763   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPHYLVKLPHLRHVDFALNYPSGTIPKEWGSTKLTNISLFVNRISGEIPKELGSITTLTCKNLEANQFYGVVPHELVSLSNLKTLILSSNKLSGKLPVTFAKFQNLTDFRISDNSFNGEIPSFIQNWKLLQRLHASGLEGPIPSNISLLSNLNQLRIGDINGPSQDFPMLRNMTGMTILVLRNCHITRELPIYFC






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo