SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g02650

Feature Type:gene_model
Chromosome:Gm19
Start:2519866
stop:2522550
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15230AT Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 4 | chr5:4945017-4946025 FORWARD LENGTH=106 SoyBaseE_val: 4.00E-46ISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02704PFAM Gibberellin regulated protein JGI ISS
UniRef100_C6SV89UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SV89_SOYBN SoyBaseE_val: 1.00E-74ISS
UniRef100_G7KKU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7KKU5_MEDTR SoyBaseE_val: 6.00E-64ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g022500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g02650.1   sequence type=CDS   gene model=Glyma19g02650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTGGCTAATAAGTTACTTTCTGTTTTGATCATTGCCCTCATTGCCATTTCCATGCTTCAAACAGTGGTTATGGCATCTCATGGACATGGAGGCCACCACTACAATGACAAGAAAAAATATGGACCTGGCAGTCTCAAAAGCTTCCAATGCCCATCACAATGCTCAAGGAGGTGTGGCAAGACCCAGTACCACAAGCCCTGCATGTTTTTCTGTCAGAAGTGTTGTAGGAAGTGCCTATGTGTGCCACCGGGGTATTATGGGAACAAAGCAGTGTGCCCTTGCTACAACAACTGGAAGACCAAGGAAGGAGGACCCAAATGCCCTTAA

>Glyma19g02650.1   sequence type=predicted peptide   gene model=Glyma19g02650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVANKLLSVLIIALIAISMLQTVVMASHGHGGHHYNDKKKYGPGSLKSFQCPSQCSRRCGKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo