Report for Sequence Feature Glyma19g02650
Feature Type: gene_model
Chromosome: Gm19
Start: 2519866
stop: 2522550
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g02650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G15230 AT
Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 4 | chr5:4945017-4946025 FORWARD LENGTH=106
SoyBase E_val: 4.00E-46 ISS
GO:0009739 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus
SoyBase N/A ISS
GO:0009740 GO-bp
Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway
SoyBase N/A ISS
GO:0019344 GO-bp
Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process
SoyBase N/A ISS
GO:0045454 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF02704 PFAM
Gibberellin regulated protein
JGI ISS
UniRef100_C6SV89 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SV89_SOYBN
SoyBase E_val: 1.00E-74 ISS
UniRef100_G7KKU5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7KKU5_MEDTR
SoyBase E_val: 6.00E-64 ISS
Expression Patterns of Glyma19g02650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g02650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g022500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g02650
Coding sequences of Glyma19g02650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g02650.1 sequence type=CDS gene model=Glyma19g02650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGTGGCTAATAAGTTACTTTCTGTTTTGATCATTGCCCTCATTGCCATTTCCATGCTTCAAACAGTGGTTATGGCATCTCATGGACATGGAGGCCACCACTACAATGACAAGAAAAAATATGGACCTGGCAGTCTCAAAAGCTTCCAATGCCCATCACAATGCTCAAGGAGGTGTGGCAAGACCCAGTACCACAAGCCCTGCATGTTTTTCTGTCAGAAGTGTTGTAGGAAGTGCCTATGTGTGCCACCGGGGTATTATGGGAACAAAGCAGTGTGCCCTTGCTACAACAACTGGAAGACCAAGGAAGGAGGACCCAAATGCCCTTAA
Predicted protein sequences of Glyma19g02650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g02650.1 sequence type=predicted peptide gene model=Glyma19g02650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAVANKLLSVLIIALIAISMLQTVVMASHGHGGHHYNDKKKYGPGSLKSFQCPSQCSRRCGKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP*