|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G15230 | AT | Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 4 | chr5:4945017-4946025 FORWARD LENGTH=106 | SoyBase | E_val: 4.00E-46 | ISS |
GO:0009739 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus | SoyBase | N/A | ISS |
GO:0009740 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway | SoyBase | N/A | ISS |
GO:0019344 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process | SoyBase | N/A | ISS |
GO:0045454 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PF02704 | PFAM | Gibberellin regulated protein | JGI | ISS | |
UniRef100_C6SV89 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SV89_SOYBN | SoyBase | E_val: 1.00E-74 | ISS |
UniRef100_G7KKU5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7KKU5_MEDTR | SoyBase | E_val: 6.00E-64 | ISS |
Glyma19g02650 not represented in the dataset |
Glyma19g02650 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.19g022500 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g02650.1 sequence type=CDS gene model=Glyma19g02650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTGTGGCTAATAAGTTACTTTCTGTTTTGATCATTGCCCTCATTGCCATTTCCATGCTTCAAACAGTGGTTATGGCATCTCATGGACATGGAGGCCACCACTACAATGACAAGAAAAAATATGGACCTGGCAGTCTCAAAAGCTTCCAATGCCCATCACAATGCTCAAGGAGGTGTGGCAAGACCCAGTACCACAAGCCCTGCATGTTTTTCTGTCAGAAGTGTTGTAGGAAGTGCCTATGTGTGCCACCGGGGTATTATGGGAACAAAGCAGTGTGCCCTTGCTACAACAACTGGAAGACCAAGGAAGGAGGACCCAAATGCCCTTAA
>Glyma19g02650.1 sequence type=predicted peptide gene model=Glyma19g02650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAVANKLLSVLIIALIAISMLQTVVMASHGHGGHHYNDKKKYGPGSLKSFQCPSQCSRRCGKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||