|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G40010 | AT | Annotation by Michelle Graham. TAIR10: AAA-ATPase 1 | chr5:16020218-16021762 REVERSE LENGTH=514 | SoyBase | E_val: 2.00E-35 | ISS |
| GO:0001666 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hypoxia | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fruit development | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010431 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed maturation | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| PTHR23070 | Panther | BCS1 AAA-TYPE ATPASE | JGI | ISS | |
| PTHR23070:SF1 | Panther | AAA-TYPE ATPASE-RELATED | JGI | ISS | |
| UniRef100_B9RUJ7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RUJ7_RICCO | SoyBase | E_val: 8.00E-35 | ISS |
| UniRef100_I1N613 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N613_SOYBN | SoyBase | E_val: 3.00E-83 | ISS |
|
Glyma19g02171 not represented in the dataset |
Glyma19g02171 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g02171.1 sequence type=CDS gene model=Glyma19g02171 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATAGTTGCTATTGCTAATTACTTAAACTATTACATGTATGATCTTGAACTCACAACAGTGAAGAAAAATACCAAACTAAGGAGGTTGTTGGTTGAAACATCAAGCAAGTCTATTGTAGTGATTGAGGACATTGATTGCTCTCTTGATCTCACCGGCCAAAGGAAGAATGAAGAAGATGAGGATATGGATACGGATGAGGAGGAACACAATAATTCTGTTAAGAAATGTGGAGAAGAAGGGAGGAGAAAATTAAGCAAGATGACTCTATCAGCATTGTTGAATTTCACCGATGGGATTTGGTCGGCTCTCATTAGGAGAGGGAGGATAGACAAGCACACAGAAATGTCATTTGTTGAAGATTATGATGTCTAA
>Glyma19g02171.1 sequence type=predicted peptide gene model=Glyma19g02171 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIVAIANYLNYYMYDLELTTVKKNTKLRRLLVETSSKSIVVIEDIDCSLDLTGQRKNEEDEDMDTDEEEHNNSVKKCGEEGRRKLSKMTLSALLNFTDGIWSALIRRGRIDKHTEMSFVEDYDV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||