Report for Sequence Feature Glyma19g02085
Feature Type: gene_model
Chromosome: Gm19
Start: 1800049
stop: 1801353
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g02085
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_G7KK07 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7KK07_MEDTR
SoyBase E_val: 2.00E-10 ISS
Expression Patterns of Glyma19g02085
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g02085
Paralog Evidence Comments
Glyma13g04915 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g02085 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g017800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g02085
Coding sequences of Glyma19g02085
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g02085.1 sequence type=CDS gene model=Glyma19g02085 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAACACATTGCCGAGATCATCATTTTCATTTCGAAGGCAAGGATCTTCTGGTCGAATATGGCAAGATCAGATACAATTCGTGGAACCAAATGCCAATGCCAGTGCTAGTCTTGGTACATCTTTGGGGAATAACAAAATCATCAAGGAGAAAAATGTGTCACAAATTGAAGGGGACATAATGGGAAGAAGGTTGCATGATAATAGTAAACGTGTCACACGCTCATCTTCTGCATCTAAAATTCATAATAATAAGAATTGGTCTCACCATGTTGTGCACGATTCTGGCTCAAACAAGAACAAGAATATCTCATATCATATCTAG
Predicted protein sequences of Glyma19g02085
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g02085.1 sequence type=predicted peptide gene model=Glyma19g02085 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNTLPRSSFSFRRQGSSGRIWQDQIQFVEPNANASASLGTSLGNNKIIKEKNVSQIEGDIMGRRLHDNSKRVTRSSSASKIHNNKNWSHHVVHDSGSNKNKNISYHI*