SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g02051

Feature Type:gene_model
Chromosome:Gm19
Start:1775750
stop:1777566
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g02051
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28455AT Annotation by Michelle Graham. TAIR10: CLAVATA3/ESR-RELATED 25 | chr3:10670220-10670931 REVERSE LENGTH=81 SoyBaseE_val: 1.00E-11ISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005102GO-mf Annotation by Michelle Graham. GO Molecular Function: receptor binding SoyBaseN/AISS
GO:0033612GO-mf Annotation by Michelle Graham. GO Molecular Function: receptor serine/threonine kinase binding SoyBaseN/AISS
UniRef100_B9RUI6UniRef Annotation by Michelle Graham. Most informative UniRef hit: CLE25, putative n=1 Tax=Ricinus communis RepID=B9RUI6_RICCO SoyBaseE_val: 1.00E-12ISS
UniRef100_UPI000233B252UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B252 related cluster n=1 Tax=unknown RepID=UPI000233B252 SoyBaseE_val: 4.00E-59ISS

Expression Patterns of Glyma19g02051
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g02051 not represented in the dataset
Glyma19g02051 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g02051
ParalogEvidenceComments
Glyma13g04895 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g02051 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g017400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g02051
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g02051
>Glyma19g02051.1   sequence type=CDS   gene model=Glyma19g02051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATATATATATACTTCTTATATTTTCTTTGAGTGATCAATGCCACAATGTTGCTGAAGCATTCTCACACCTTTGCACAGGGAGGAAAATCAAACTGATAAAGAGGGGTGAAGATATGGGTGTTGGTGGTGTCATTAGTTGTAAAAAGTTGCTTCTTGGAGCCTTGGTATCTTTAGGAGTCATCTGGTTTATGTTCCTTGCAATCTCAGTGAACCGTCAAACCAAGAGGACAGTGCTAGTTCCAATGAATGTTATCTCAAAGCATTTGAAGTTGGTTAGCATGCAGAGGCATGCCCTGCATTCAAATTCTGGACTATTCATTGTGAGCAAGAGAAGAGTGCCAAATGGACCTGATCCAATACACAACAGGAGAGTGGTGAAAACTAGACGGCCACCTACACAAGCCTGA
Predicted protein sequences of Glyma19g02051
>Glyma19g02051.1   sequence type=predicted peptide   gene model=Glyma19g02051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YIYILLIFSLSDQCHNVAEAFSHLCTGRKIKLIKRGEDMGVGGVISCKKLLLGALVSLGVIWFMFLAISVNRQTKRTVLVPMNVISKHLKLVSMQRHALHSNSGLFIVSKRRVPNGPDPIHNRRVVKTRRPPTQA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo