Glyma19g01740 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g01740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g01740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g01740

Feature Type:	gene_model
Chromosome:	Gm19
Start:	1328017
stop:	1329298
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g01740

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G59970	AT	Annotation by Michelle Graham. TAIR10: Matrixin family protein \| chr1:22073601-22074683 FORWARD LENGTH=360	SoyBase	E_val: 9.00E-64	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031012	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0004222	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity	SoyBase	N/A	ISS
GO:0008237	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR10201	Panther	MATRIX METALLOPROTEINASE	JGI		ISS
PTHR10201:SF15	Panther	MATRIX METALLOPROTEINASE-RELATED	JGI		ISS
PF00413	PFAM	Matrixin	JGI		ISS
PF01471	PFAM	Putative peptidoglycan binding domain	JGI		ISS
UniRef100_G7KJD9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Interstitial collagenase n=1 Tax=Medicago truncatula RepID=G7KJD9_MEDTR	SoyBase	E_val: 2.00E-80	ISS
UniRef100_I1N5Y2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N5Y2_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g01740

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g01740 not represented in the dataset	Glyma19g01740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g01740 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g014400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g01740

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g01740

Limit To All Plant Sequences

>Glyma19g01740.1   sequence type=CDS   gene model=Glyma19g01740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTTAATCTTCTAAATCTTTCAATCTTGTTCTTTTTACTCTTTATTGTGAATCCATTTCCCTTTGTCGAGCCAAGAGCCTTACAATTACCTGTGTTCACCAAAACTCTCCAAAACCTCAGGGGCGTTCACAAGGGACAAAAGGCGAACGGTGTGGGAGAACTCAGAAGCTACCTCCAACATTTTGGCTACCTAACAAACGGTGATTCTTCGAACGACAACTTCGACAATAATGTCGAGTCTGCTCTCAAACACTACCAAGAGTTCAATCACTTACGTTCCACTGGTGTGGTAGATGACGAAACTATCAAAAGAATGAGCCTCCCACGTTGTGGAATGCCTGATATTGTCACCCAACCTAACGCTAACCAGTTGTTGGTGGCCCCTAACAACTACAGCTTCTTCCCGGGGCAACCTAAATGGAGAAAATTTGCACTAACCTATGGACACATGTCAAGTGTTGTCTTGTCCAATAACTTCTTCAGCTCTGTGAGGGCAGCAAAATTGAGAGCCTTGCAAACATGGGCTAGAGTCACCAACTTCACGTTTACAGAAAGGGCCCCACCAGCTGACATAGTCTATGGGTTCCATCGTGGGGACCACGGTGATGGCTACCCATTTGACGGGCCGTATGGGGTGCTAGCCCATGCTTTTGCGCCACAAAATGGGAGGTGCCACTATGATGCAGATGAACCATGGGATTTTAATGGGCAAAACATTGATTTTGAAACAGTAGCTTTGCATGAATGTGGTCACCTTTTAGGGCTTGGACATAGTAATACTCGGGGTTCGGTTATGGAAGCCACTTATGCAGGGCAAAGGAGGAGTTTAACGCAGGATGATATTGATGGCATACGAGCTCTATATCAGTTCTAG

Predicted protein sequences of Glyma19g01740

Limit To All Plant Sequences

>Glyma19g01740.1   sequence type=predicted peptide   gene model=Glyma19g01740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALNLLNLSILFFLLFIVNPFPFVEPRALQLPVFTKTLQNLRGVHKGQKANGVGELRSYLQHFGYLTNGDSSNDNFDNNVESALKHYQEFNHLRSTGVVDDETIKRMSLPRCGMPDIVTQPNANQLLVAPNNYSFFPGQPKWRKFALTYGHMSSVVLSNNFFSSVRAAKLRALQTWARVTNFTFTERAPPADIVYGFHRGDHGDGYPFDGPYGVLAHAFAPQNGRCHYDADEPWDFNGQNIDFETVALHECGHLLGLGHSNTRGSVMEATYAGQRRSLTQDDIDGIRALYQF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain