SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g01660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g01660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g01660

Feature Type:gene_model
Chromosome:Gm19
Start:1269897
stop:1271219
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g01660
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77940AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein | chr1:29304116-29305288 REVERSE LENGTH=112 SoyBaseE_val: 6.00E-13ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR11449Panther RIBOSOMAL PROTEIN L30 JGI ISS
PF01248PFAM Ribosomal protein L7Ae/L30e/S12e/Gadd45 family JGI ISS
UniRef100_G7KSW7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L30 n=1 Tax=Medicago truncatula RepID=G7KSW7_MEDTR SoyBaseE_val: 5.00E-12ISS
UniRef100_I1N5X7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5X7_SOYBN SoyBaseE_val: 5.00E-57ISS

Expression Patterns of Glyma19g01660
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g01660 not represented in the dataset
Glyma19g01660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g01660 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g01660
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g01660
>Glyma19g01660.1   sequence type=CDS   gene model=Glyma19g01660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCTACAAAAGACCGTCTTTGAACATTGCTTTCCCCTTTTTCCACCACGGAAATTGATTATCATTGCTAACAACTGTTCCCCTTTGAGGAAGTGGGAGATTGAATACTATGCTATGTTGGCAAATGTTGGAGTTCATCATTACAATGGGAGCAAACAATGTGGATTTGGGCACTGCATGTGGAAAATATTAGAGTGTGCTGCCTTAGCATTATTGATCCTGATATCTGATGTCATGGGAGCTATTGGGCCTAAT
Predicted protein sequences of Glyma19g01660
>Glyma19g01660.1   sequence type=predicted peptide   gene model=Glyma19g01660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLQKTVFEHCFPLFPPRKLIIIANNCSPLRKWEIEYYAMLANVGVHHYNGSKQCGFGHCMWKILECAALALLILISDVMGAIGPN






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo