SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g01550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g01550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g01550

Feature Type:gene_model
Chromosome:Gm19
Start:1159645
stop:1164330
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g01550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38490AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:18006385-18007203 FORWARD LENGTH=153 SoyBaseE_val: 4.00E-30ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
PF00584PFAM SecE/Sec61-gamma subunits of protein translocation complex JGI ISS
UniRef100_I1N5W5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5W5_SOYBN SoyBaseE_val: 3.00E-109ISS

Expression Patterns of Glyma19g01550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g01550 not represented in the dataset
Glyma19g01550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g01550
ParalogEvidenceComments
Glyma13g04460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g01550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g012500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g01550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g01550
>Glyma19g01550.1   sequence type=CDS   gene model=Glyma19g01550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGATTCTTTCCTCGTTGCCACTGAACTATTCAGCTTTCCTTCGTCAAGGTACTCCTTTTCTGCCATCAAAGTTTCCAGCAAGAGTTGATTGTCACAGAAATGTTTCTCAGACATCACAAACGATTTTTAGAATAAAAATAAGAGAAAAACATGCAAACTATAGTTGCACCAAATTTGTGACCTCTGCTGCAAGGAATGATCATCATCTAAGCTATGATGATGATTTACCTCAGGAGCCCTTTTTGCTAACATTGATCAAGGATGCCATATGGGGGCTAAGATATATATTTGTATTTTTGGCTGAGCAACCTAGCCAGTTTAAATACATAGAGTGGCCAAGCTTTAGTAGTACGCTGAGGACCGCAATTCTGACTCTTATACTTGTTGCAATGCTTATTGTTGCATTATCATCTGTTGATTCGGCTCTCAGCTATCTATTGGCTTTTGCTCTTCGGAAAAGACCATAA
Predicted protein sequences of Glyma19g01550
>Glyma19g01550.1   sequence type=predicted peptide   gene model=Glyma19g01550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVILSSLPLNYSAFLRQGTPFLPSKFPARVDCHRNVSQTSQTIFRIKIREKHANYSCTKFVTSAARNDHHLSYDDDLPQEPFLLTLIKDAIWGLRYIFVFLAEQPSQFKYIEWPSFSSTLRTAILTLILVAMLIVALSSVDSALSYLLAFALRKRP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo